SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Eucgr.H00063.1|PACid:23589389 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.H00063.1|PACid:23589389
Domain Number 1 Region: 171-465
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.35e-77
Family Protein kinases, catalytic subunit 0.0002
Further Details:      
 
Domain Number 2 Region: 2-210
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.46e-34
Family Legume lectins 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Eucgr.H00063.1|PACid:23589389
Sequence length 513
Sequence
MVEFDTYMNWEFDPHWYHIGINQNSLSSVVLAPWDPVSQSGKAVNVNVTYNSASKNLSVF
WSFDGKPPSHYKANHSLSCLVDLARVLPESAVIGFSASIGEHPERHSVNSWEFTSDLDDV
DEPRRLWILVVVPTTCFLLVISASSCFLAVKRREKHGYSALTDIDKEIGALPTKFTYQEL
LAATNGFADDRRLGRGGSAQVYKGFLSHSNRLVAVKRIFAESRHSEKVFVNEVKIISRTI
HRNLVPFVGWCQEEGEFLLVYEYMPNGSLDHHLFGPRRSLPWAVRYGVALGLASALNYLH
EELEQWVLHRDIKAANVLLDTNFTTKLGDFGVAKLIDPRFRSQTTDVVGTCGYLAPEYFI
SGKATKESDMFSFGVVALEIACGRRSYEDGGVWVALHKWVWELYRASNILGAADEALGSG
FRRDEMECLMMVGLWCVHPDPARRPKAGQVIRFLQLEDSVPELPHDAFNGPVSHRPSASQ
LGILESPSAPPIQESVFRKLDKSCLLKSYGNTC
Download sequence
Identical sequences A0A059AUA3
Eucgr.H00063.1|PACid:23589389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]