SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Eucgr.H02035.1|PACid:23591409 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Eucgr.H02035.1|PACid:23591409
Domain Number - Region: 59-89
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00222
Family SMI1/KNR4-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Eucgr.H02035.1|PACid:23591409
Sequence length 384
Sequence
MVDVDRRITGITPAHVAGLRRLSARAAAAPSAAASRNGLLSFSSLSDQAMTHLRSSGVQV
QPGLSEADFARAEAEFGFSFPPDLRAVLSAGLPVGPGFPNWRAAAGPARLHLRASLDLPT
ASVSLQWPATRSGPMLGPEAARPGEVPPAHCYIPSAPSLAGNPIFFVDEHRVFCCGSDLS
DFFHRESLFRSSDYEPEEEAALQRQRSLGARRSVDGRGGGAGRSTRWVEFWSDAAFDRRR
RISSSSSSSSQSSSSSPERFFDLPADTQHPKWVDEYMERIGSVLRGGGWSESDVSEMLEV
SASADDVFSGGTAFAVDRQAVLDSLLLKADRFSDRLRKAGWSSEDVADAFFGFDFRPGKE
KRPARKLAPKLVERLGRLAESVSQ
Download sequence
Identical sequences A0A059AZE4
Eucgr.H02035.1|PACid:23591409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]