SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Eucgr.H02417.1|PACid:23591716 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.H02417.1|PACid:23591716
Domain Number 1 Region: 177-451
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.12e-46
Family Protein kinases, catalytic subunit 0.0012
Further Details:      
 
Domain Number 2 Region: 2-173
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.45e-39
Family Legume lectins 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Eucgr.H02417.1|PACid:23591716
Sequence length 465
Sequence
MVYEGNARPHVGTIEFTSHTSSWRLTDFSTLFSFIIDTQNQSEYGSGLAFFLTPVGFQIP
VNSTGGFLGLFNTTYNDLSSNQIVGVEFDTFANPKWDPPYEHVGINKNSIALALTTPWNA
SFHSGDTADVWIVCNSTTKNLSISWSYQITRNRYEKTSISYQIDLTAVLPEEFVREGPWR
FTYADLVSATNNFAEERKMGEGGCRAVYKGHLVGLDAAVAVKQISRGLKQGNEEFITEVK
MINSLGPRNLVQLIGWCHKANEFLLVYAFMPNGSLNRHLFGKRRPLNSRFKVKLGDLGLA
RLMDHELGPLMTRLARKFGYLATEYMSTGRASKQSYVYSFGVVALEIVTGRRSVDPMEQS
SQMNLVEWVWELHGKNRVVKAVDERLKMDFDGKQVERLLVVGLWCAHPDKGLRPSVRQAL
QALNFEIPVPVLPYKMSPAVYPVTPSATTYVPYLFKEFIPPPHIR
Download sequence
Identical sequences A0A059B0W3
Eucgr.H02417.1|PACid:23591716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]