SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Eucgr.H02421.1|PACid:23591720 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.H02421.1|PACid:23591720
Domain Number 1 Region: 291-597
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.56e-82
Family Protein kinases, catalytic subunit 0.00012
Further Details:      
 
Domain Number 2 Region: 7-230
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-64
Family Legume lectins 0.0000105
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Eucgr.H02421.1|PACid:23591720
Sequence length 610
Sequence
ISRFNPQATDIIYEGDARPNVGTIDFTSATYFFHVGRAFYAEKLQLRNSTSKRLTDFSTR
FSFTIDTENQSEYGAGFAFFLAPVGYQIPVNSNGGFLGLFNTTYSNSSSNQIIAVEFDTF
TNPEWDPPYEHVGININSIASVVTTPWNASFHSADTADAWIVYNSTTKNLSVSWSYRTTP
NPHENTSISYQIDLTTVLPEEVMIGFSAATDYYTERHQLESWSFSSNLEVTEKQGNTNRN
KLVVGLAVPLGFLLCGGVAISAILWRRKSRSKGSEMANLTSINDELERGAGPRRFRYTDL
VAATNNFNEERKLGEGGFGAVYRGYLVSLDAAVAVKRISRGSKQGKKEFITEVKVVSSLR
HRNLVQLIGWCHEANEFLLVYEYMPNGSLDMHLFGRKSPLGWAARYKISVGLASALLYLH
EEWEQCVVHRDIKSSNVMLDSGFNVKLGDFGLARLMDHELGPQTTGLAGTFGYLAPEYVS
TGRASKESDVYSLGVVVLEIGTGRKSVDPMEQSLEMSLVEWVWHLYGRGQIVEAMDERLQ
VDFVRKQVECLLVVGLWCVHPDRSLRPTVRQALQVLNFEAAVPVLPNKMPVTVYHAPSPP
SVNSGEPLIT
Download sequence
Identical sequences A0A059B0L8
Eucgr.H02421.1|PACid:23591720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]