SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Eucgr.H03305.1|PACid:23592610 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.H03305.1|PACid:23592610
Domain Number 1 Region: 36-98
Classification Level Classification E-value
Superfamily At5g01610-like 0.00000000000000105
Family At5g01610-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Eucgr.H03305.1|PACid:23592610
Sequence length 120
Sequence
MPGEVPVLAHRDGAPQRAAPAQGHRGMRVREGDRLRITAQIEHGKIKKLTGVKTKELLVW
VTLCDIYLDDPPTGKITFKTPSGLYRSFPVSAFEIEEPAKDGGKAKGVEGASAAVEVKEV
Download sequence
Identical sequences A0A059B3I1
Eucgr.H03305.1|PACid:23592610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]