SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Eucgr.H03724.1|PACid:23593016 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.H03724.1|PACid:23593016
Domain Number 1 Region: 337-628
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.7e-78
Family Protein kinases, catalytic subunit 0.0000803
Further Details:      
 
Domain Number 2 Region: 34-282
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.12e-55
Family Legume lectins 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Eucgr.H03724.1|PACid:23593016
Sequence length 668
Sequence
MGRALAPLPVNPTFLSLLLLLLHLISSFQPVEALGFQFSTFDPSADYGALEVKSPALIYN
DALQLTPDSSSGTVDFMNKSGRILYKQGFKLWDGPPEAPTKIASFNASFVINIFRINNGT
PGEGLAFIVAPDLNLPVGSFGGYLGLTNATTDGQASNHLLAVEFDTFKQDYDPDANHIGL
DINSVESNQTVPLADHGFELAPNYTVFFHVWIEYDGGRELLEVYMIDENETTPTKPKPAS
PIMTASLDMSKVVNQNSHFGFAASTGDNAELNCVLGWNMTVEELPQGTPAGLVIGLAVGI
PAAALALAGAAALGVWAWRRRAAGRDPNLVGTLKCLPGMPREFKFKDLKRATGNFDEGNK
LGQGGFGVVYKGVLAAENRQVAVKKFSRDELKSKDDFLAELTIINRLRHRHLVPLLGWCH
QNGMLLLVYEYMPNGSLDGHIFCGPERQTLEWSHRYKIVVGVASALHYLHDEFDQKVLHR
DLKASNIMLDSNFNARLGDFGLARAIDNEKNSYAELEGVPGTVGYIAPECLHTGKATRES
DIFGFGAVILEVVCGQRPWRRAGFDGFQFLADWVWSLHRDGRILEAVDGRLGDDYAVEEA
RRLLLLGLACSHPSAAMRPNTPTIVQILSGSVDVPHVPPFKPSFVWPSASLLSEDGDTTD
VTLMVSSS
Download sequence
Identical sequences A0A059B448
Eucgr.H03724.1|PACid:23593016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]