SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Eucgr.H04699.1|PACid:23594037 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.H04699.1|PACid:23594037
Domain Number 1 Region: 288-413
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.68e-22
Family Regulator of G-protein signaling, RGS 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Eucgr.H04699.1|PACid:23594037
Sequence length 465
Sequence
MAGCAGEGGCPSDYVAVAISFLSLILLLYRSILPFVIHKFSRTKGSGFWIPVLQVFASFN
LILSIVMSVDLLKFERRHWWQSCYVWAVWIEGPLGFGLLLSCRIVQAFQLYFIFAKRRLP
PMRSHVCLPLFLLPWFAGAAFIHVKQPLNNHCHMGAQWVVPVVSFHTLYVATLVAFTGAI
RHIEFRFNELRDLWRGIVLSASSIGVWIAAYVLNEIHDEIAWLQVVSRFLLLVTSSILVL
AFFSISSSQPLLSQISLRRREPLKYETMGQALGIPDSGLLMQREPSQAIDPDEPLDKLLL
NKRFRQSFMAFADSCLAGESVHFHDDVHELGKIPVNDSVRRIYMARDIIDKYITAGAPME
VNISYRCRQDILMTSNLAHPDLFNNALNELLQLMKMNLAKDYWSSTFFLKFKEEASMRLD
AHEMEPMTGWNFSPRLSGVRGADDPFHQEYLTKDSDHSSGNTDAT
Download sequence
Identical sequences A0A059B8P6
XP_010025375.1.83385 Eucgr.H04699.1|PACid:23594037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]