SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Eucgr.I00577.1|PACid:23595116 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.I00577.1|PACid:23595116
Domain Number 1 Region: 320-608
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.34e-82
Family Protein kinases, catalytic subunit 0.0000932
Further Details:      
 
Domain Number 2 Region: 22-262
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.29e-71
Family Legume lectins 0.00000443
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Eucgr.I00577.1|PACid:23595116
Sequence length 621
Sequence
MANLSCLAIQFLTFLLLLIGHAHSVSFNFSGFQPNTGNLTFEGDAFTSSGGIQLTRNQQD
NNLQNSIGRASYDKPVRLWDSKTGRLTDFTAHFSFVINALNNTYYGDGISFYIAPFDAVI
PANSSGGYLALFEPSMAMNTSANQIVAVEFDSFKNSWDPSPDHVGININSIVSVANVSWK
TSMKNGSTANAWVSYDSTSFNLSVFLTYANNPVFNNNSSLSYVVDLRKILPEQVKIGFSA
ATGQFVEIHEILSWSFSSTLEDGKKKRSLGLVLGVVLGSGLVACVLGIGWFLFWRKKSRR
SKGVSMVDISIDGEFEKGAGPKRFTYRDLARATNDFTERGKLGEGGFGGVYKGLLSESNM
EIAVKRVSKGSKQGKKEYVSEVKIISRLRHRNLVQLIGWCHEGGELLLVYEFLPNGSLDS
HLFGGKTHLTWAARYKIALGLASALLYLHEEWEQCVVHRDVKSSNVMLDSNFNAKLGDFG
LARLVDHDMGSQTTVLAGTMGYLAPECVTTGKASKESDVYSFGVVALEIACGRKPVELRV
EPSKVRLVEWVWDLYGRGRVVEAADPGLNMEFDERQMECLMVVGLWCCHPDYSLRPPIKQ
VINVLNFEAPLPSLPSKLPVP
Download sequence
Identical sequences A0A059AKV7
Eucgr.I00577.1|PACid:23595116

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]