SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Eucgr.I02194.1|PACid:23596912 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.I02194.1|PACid:23596912
Domain Number 1 Region: 305-595
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.86e-79
Family Protein kinases, catalytic subunit 0.0000863
Further Details:      
 
Domain Number 2 Region: 4-250
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.46e-57
Family Legume lectins 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Eucgr.I02194.1|PACid:23596912
Sequence length 634
Sequence
PVEALGFQFGTFTPSTDYDTLAAIDPALIYNNALQVTPDSRGSVILTNRSGRILYKQGFK
LWDGPPEAPTKVASFNTSFVISIFRINNGTPGEGLAFIVAPDQNLPAGIFGGHLGLTNAT
TDGHASNHLLAVEFDTFRQDYDPDANHIGLDINSVVSYQTIPLADHGFDLAPNHTVFFHI
EYDGGRELLEVYMIDEDESTPTKPKPASPIMTANLDMSKVVNQNSYFGFAASTGDNAELN
CVRSWNMTVEELQKGTPAGLVMGLAIGIPAAALALAGAAALGIWAWLRRAAARDPNIVGT
LKCLPGMPREFKFRDLKRATENFDEGSKLGQGGFGVVYKGVLTENRQVAVKKFSRDQLKS
KDDFLAELTIISRLRHRHLVPLLGWCHQKGMLLLVYEYMPNGSLDGHIFCGSERQRLEWS
HRYKIVAGVASALHYLHDEFDQKVLHRDLKASNIMLDSNFNACLGDFGLARAIDNEKNSY
DELEGVPGTVGYIAPECLHTGKATRESDIFGFGAVILEVVCGQRPWRRAGFDGFQFLADW
VWSLHHDGRILEAVDGRLGGDYAVEEARRLLLLGLACLHPIAAERPNTPSIVQILSMEVP
HVQFKPAFVWPSAGLLNEEGDTTDVTPMMSSLQF
Download sequence
Identical sequences Eucgr.I02194.1|PACid:23596912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]