SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Eucgr.J00855.1|PACid:23598719 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.J00855.1|PACid:23598719
Domain Number 1 Region: 889-1034
Classification Level Classification E-value
Superfamily VC0467-like 1.57e-22
Family VC0467-like 0.0017
Further Details:      
 
Domain Number 2 Region: 678-737,776-822
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000184
Family PDI-like 0.026
Further Details:      
 
Weak hits

Sequence:  Eucgr.J00855.1|PACid:23598719
Domain Number - Region: 592-642
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0969
Family PDI-like 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Eucgr.J00855.1|PACid:23598719
Sequence length 1046
Sequence
MKEIAHSLHKRKEEFGSLRLMFMYKNVEKMLADAIGASQETTILYYHHSTSYKYHGRLRA
QNILWSLRPYLTVPPENLPLELINLEQDLKSFLDSTDRALLLLEFCGWAPELLIRERKNG
TEHGYVSQGDIVEANYHEKTDSMSTFIASKKQKSLENGVAQCGVQNAFYGIPSFGESSLV
NDSSTTDSTEDERHGLGVSCNFGEFQQFESFFSKFTMAAREFFLPPERHRFGLITNRSLL
LSLGVGEINSWSAMIHYAGCPSCSKYLKKEEDLERFLQMEDPAVAELEDNEPNLGPALPA
NKPSILLFVDRSSDSSETRIKSKEALDAFRELALQYHIPVHMREKNKEELGKFSAHSHLS
SRSMPRHPKAPGSTSRHPKLKLYQSAQSVKLGDKVSIMIVNEEKHVTLDKISTDVQASSL
HEVLENLLQKNKAAKLSSLAKKAGFQLLSDDFEIKIANPLSPQTEIQPNQATVELSKEDL
VNQIDRDQEKVMDIVSTSAAGLGENMNPTGSGLLRHDEEKIDTANLSDDLTSAESEQFFT
NTELDNFEDAGVDEIHLSKVDKLREQLQSRGLEGSFYFLDGNYQLLKALTGGLKVPSLVI
IDPVMQCHYLFPDQTHFSYTSLANFVNGYLNGSLLPYQHSESLIPMLRDAARPPFVNLDF
HEADSIPRIAAKTFSELVFGFNHSEIGNVAPARRKDMLVLFSNSWCGLCQRMELVVREVH
RALRGYMNMLSHKFQNAQTQFSSDLGSSSYMEDNMEDMAQKLPLVFLMDCTMTDCSLIFK
AINQRERYPALMLFPAENRTPVSYDGDMAVASIVKFLADHGSYSHNLINEKGILWTPAKY
GMGQNSFSTSPKDQLQDFLLQNTAADRTVKYSRTKMPKSNGLDGAASHVVAGSILVATEK
LLGMHPFDNSQILIVKADKASGFQGLIINKPISWDLLHELEEGSEFLKEAPLSLGGPLVN
RRLPLACLTRVDKNQYLEILPGIRFIDQLETIREIDELRAGNGSVADYWFFLGYASWGWD
QLFDEIDKGAWNIKEDALKEFTWPRP
Download sequence
Identical sequences A0A059AC26
Eucgr.J00855.1|PACid:23598719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]