SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Eucgr.J02577.1|PACid:23600729 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.J02577.1|PACid:23600729
Domain Number 1 Region: 310-583
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.19e-57
Family Protein kinases, catalytic subunit 0.00046
Further Details:      
 
Domain Number 2 Region: 26-256
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.07e-53
Family Legume lectins 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Eucgr.J02577.1|PACid:23600729
Sequence length 602
Sequence
MVFSETQGRRTIEKPGPFDESDHDVFEVLKPASINNGALQVTPDSGGEFDLSKKSGRIML
KESFKLHDKGARVASFNTSFFINIQNHFSTSSHGEGMAFVIAPDLVLPPGSEGQYLGLTN
ATTDGNATNRLVAIEFDTFKQDFDPDDNHIGLNINSVKSELNVSLSDSGIQLVPEVAKNF
TIWIQYDGLNKILQVFMVGEDNPEPAEQRPNDPVMIADLDIAKYVNERSYFGFAASTGSA
IELHCVLGWNLTLEGPPEDEGLVIEAKIALGVGVAFLVILLAGWWIQRTLYKKYKTANDP
TIRGTLQSLPGTPREFRYRDLKVATDNFNEKNKLGQGGFGVVYKGVLSKESLQIAVKRFS
RDNVKSKDDFLAELTIINRLRHKHLVKLLGWCYKNGKLLLVYEYMPNGSLDAHIFCGAEK
ETLRWDLRYQIISGVASALHYVHNEYEQKLEGVPGTLGYIAPECLHTGKATRESDIYGFG
AVVLEVVCGQRPWTKIGGFCFLVDWVWSLHRDGRILEAVDERLRGDYVAEEAERLLLLGL
ACSHPNASERPKTQAVLQIASGLLPVPYVPPFRPAFVWPSAGAVEENIDSEYTDDLTVTI
LH
Download sequence
Identical sequences A0A059AHU2
Eucgr.J02577.1|PACid:23600729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]