SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Eucgr.K01640.1|PACid:23603150 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.K01640.1|PACid:23603150
Domain Number 1 Region: 280-583
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.62e-79
Family Protein kinases, catalytic subunit 0.00015
Further Details:      
 
Domain Number 2 Region: 17-227
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.79e-40
Family Legume lectins 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Eucgr.K01640.1|PACid:23603150
Sequence length 614
Sequence
VAHSDAIQANFSFYGLLKLEGVLEVDSNGVIVITNSTTQDAGYMYYSSPLQFKNSSTGDV
FSFSTTFVFAVPSADLSDGSGFSFIISPSKGIPGIWPHNSARSLNNSNYWNSSNNMIVLE
LDRIVSNNQYGSSNLMLKTGEPIQTWVEYNSANKQVKVTLYPVNTPRPSVPLVTLTQDFS
SYMDEDMYVGFSSFTETSSTSHYILAWNFKMNGEAEDIEASRLPKLPIGAGGNGGYRNIK
KILAVVLSLSAATFVLVLIFGAILVSRKRRSREVLEDWEVQYGPHKFTYKELFAATKGFK
DRELLGKGGFGRVYRGLLLASNMQIAVKRVAHDSNQGMREFVAEIATIGRLRHPNLVRLL
GYCRHKQELFLVYDYMPNKSLDKYLYGQPKLTLDWGMRYKILKDVAAALFYLHQQWAQVV
IHRDIKASNVLIDGEMNGRLGDFGLAKLVDHGTDPQTSVLAGTLGYIAPELARTGKASTS
TDLFAFGVFMLEVVCGRRPLHPRAPADQILLAEWVLNCWERGELLEVVDGRLRNDYAAEE
AELALKLGLYCSHAVAAARPSMSSVVQYLNGVSRLPDNLRDIIEARDFPGSTSATSSVVP
RSMSISSLTFSASL
Download sequence
Identical sequences A0A059A278
Eucgr.K01640.1|PACid:23603150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]