SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Eucgr.K01843.1|PACid:23603343 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.K01843.1|PACid:23603343
Domain Number 1 Region: 222-381
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.42e-38
Family Protein kinases, catalytic subunit 0.0012
Further Details:      
 
Domain Number 2 Region: 3-226
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.31e-33
Family Legume lectins 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Eucgr.K01843.1|PACid:23603343
Sequence length 428
Sequence
MCLKFNYPIFVEADENHFVRNNSYIVLNSLQVTPDVIVASISNLSDCILYKDPFKLWKKK
GDSRDITSFNSTFVLNITPHTVPGGEGLAFLITGETGLPDNSHGRWLGNVNSTTDRLPGR
AMQETGDDNHVGLNVNSIFSLKQKPLADYSVNLWTATNITARVEYDGKNIPLSVFLSNET
GEYMKNPIISVPLNLSEYLLQDVFLGFSAPTSNYTELNCISGPTLNWQRRYNIINGVAKA
LDYLRNGCKKKVLHQDVKASNIMLDLGFNARLGDFGLVHTIQQTEQTHHSTKEIAGTRGY
MAPESFLTGRATMETDIYEFGILMLEVFCGREPGDHCVLADSRMGGDFGDGEMEDMFVLG
LACCHPNPNCRPSMRSVLQVLTGQVAPPIVPLERPAFIWPSMPPSFREDFDCSIAKGQMT
PITEVRRR
Download sequence
Identical sequences A0A059A2R9
Eucgr.K01843.1|PACid:23603343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]