SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Eucgr.K03075.1|PACid:23604755 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.K03075.1|PACid:23604755
Domain Number 1 Region: 252-506
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.91e-59
Family Protein kinases, catalytic subunit 0.00019
Further Details:      
 
Domain Number 2 Region: 22-206
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.15e-46
Family Legume lectins 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Eucgr.K03075.1|PACid:23604755
Sequence length 564
Sequence
MFFVILLAVSPLANFALAQDASSFTYNGFRSANLSLDGLATFTGNGLLRLTNATKQKQSH
AFYPDPIKFKNSSSGSAFSFSTTFVFAMISDYPPLGGYEFAFLLIEKFPRALPCYYFGPF
NETDNGNSSNHIVAVEFDTIQNHEFLDINDNHVGIDVNGLTSVKSAPTGYSPSPVTSHYI
VGWSFKVNGQAQGLVLSQLPRLPHVRKEEKSYLLTIGLPFMLLSCLSMLILSVVYLIRRK
KKFAEVLEDWEHDYSPYRFKYKDLYVATKGFRDQELLGAGGFGRVYRGVLSTSKTEIAVK
RVSHESRQGMREFIAEIISIGQLRHRNIVTLLGYCRRKGELLLVYDYMLNGSLDKYLYNQ
PKVTLNWSQRFRVIKGVAYGLSYLHERWEKVVIHRDIKANNILLDSELNGRLGDFGLAKI
YNHGTDPHTTRVVACGRRPIEAQEKGDVILVDWAFSCWDKGDILEARDPNLGTDFVAKDV
ELALKLGLMCSHSEPTARPRMHQVQYLEGDVAMHELSCLVNLKSGLTFAYHEGCSMSGMY
YPSSAEKAFSQTSPVADSLLSGGR
Download sequence
Identical sequences Eucgr.K03075.1|PACid:23604755

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]