SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Eucgr.K03082.1|PACid:23604760 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.K03082.1|PACid:23604760
Domain Number 1 Region: 9-266
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.34e-72
Family Legume lectins 0.00011
Further Details:      
 
Domain Number 2 Region: 311-576
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.51e-51
Family Protein kinases, catalytic subunit 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Eucgr.K03082.1|PACid:23604760
Sequence length 625
Sequence
MTPTHETGDFMYNGFWSANLSLDGLAALTGNGLLKLTSVNQQDKSHAFYPDPIMFKNSSD
GAVHSFSTTFVFATIAEDPALAGPGFTFVIAPRREFPGDWPGYLFGLFNMTNYGNSSNHI
FVVEFDTIQNIEVQDIDDNHLGIDVNGLVSLNSSPAGYTENNIPGFRNLSLISGKAMQVW
VDYDGVQKQIRVTLAPVNVDKPNTPLLSLSFNLSPIFKETMYVGFSSSTGALSTSHYILG
WSFQVNGQAHRLDLSQLPRLPHMKKKQKSVLLTTGLPFICLFFLSILVFAMAYAIRKRRK
FAEVLEDWERDFSPHRFKYTDLYVATKGFRDQELLGAGGFGRVYRGVLPTSKIEIAVKRV
SHESRQGMRQFIAEIVSIGRLRHRTHCDTSRILPSESQRSRVIKGVAYGLYYLLEGRDQV
VIHRDIKASNILLDSELNGRLGDFGLAKLYDHGTDPQSTMWWELWVYSPENTRTARATTS
TDVYAFGAFLLEVACGRRPIEVQEEDDVILVEWVFSCWDKGDILEARDPNLETDFVAKEV
ELVLQLGLLCSQSQPTARPCMRQVVQYLEGDLILEELSSLGISKSGLQFAYHESFIKSIM
SDPSSSVKAFSQISSVPNSPLSGGR
Download sequence
Identical sequences A0A059A6V3
Eucgr.K03082.1|PACid:23604760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]