SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Eucgr.K03090.1|PACid:23604766 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.K03090.1|PACid:23604766
Domain Number 1 Region: 23-279
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.63e-78
Family Legume lectins 0.0000626
Further Details:      
 
Domain Number 2 Region: 312-551
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.56e-65
Family Protein kinases, catalytic subunit 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Eucgr.K03090.1|PACid:23604766
Sequence length 598
Sequence
MLFVIALAVSLLAKTAPTHETGDFTYSGFRSANLSLDGSAVLTRNGLLKLTNVTPHQVSH
AFHPDPITFKNSSNGAVHSFSTTFIFAIIPEYPTSGGPGFTFVIAPRREFPGAKPGFYFG
LFNETNNGNATNHILAVEFDTFLNAEIQDINDNHVGIDVNGLVSIKSFPAGYIENDIQGF
RNLTLISGKAMQVWVDYDGVQKQIRVTLAPVNVDKPNTPLLSLSFSLSPIFKETMYVGFS
SGTGVLLTSHYILGWSFKVNGQAHRLDFSQLPRLPHEKKKQKSILLTTGLPFICLFFLSI
LVFAMAYAIRKRRKFAEIVSIGRLRHRNIVTLLGYCRRKGELLLVYDYMPNGSLDKYLYN
QPNETLSWSQRFRVIKGVAYGLSYLHEGWEQVVIHRDIKASNILLDSELNGRLGDFGLAR
LYDHGMDPQTTHLVGTLGYLAPENTRTARATTRTDVFAFGAFLLEVACGRRPIEAREEED
VILVDWVFSCWDKGNILEARDPNLGVDFVAKEVELVLQLGLLCSQSEPTARPSMRQIVQY
LEGDLVMPELSSLGISKSGLTFAYHEGFSRSIMSDPSSSDKAFSHMSSVADSLLSSGR
Download sequence
Identical sequences Eucgr.K03090.1|PACid:23604766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]