SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Eucgr.K03098.1|PACid:23604774 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.K03098.1|PACid:23604774
Domain Number 1 Region: 24-241
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.33e-57
Family Legume lectins 0.00094
Further Details:      
 
Domain Number 2 Region: 289-560
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.34e-45
Family Protein kinases, catalytic subunit 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Eucgr.K03098.1|PACid:23604774
Sequence length 581
Sequence
MFFMIVLVVSSLANSALFQDSGIFTYNGFRSANLSLDGLATFTGNGLLRLTNATKQKQSR
AFYPDPIMFKNSSNGYAYSFSARFVFTMIYEYPPLGGYGFAFNFTQSKNHVFLDINDNHV
GIDVNGLTSVKSAPAGYIASPGEVFTNLSLTGGKAMQVWVDYNGSQKQFNVTLAPINVEK
PNTPLLSLPIDLSPIITETMYVGFSSSTGSLITSHYIVGWSFKVNGQAQGFVLSQLPRLL
HARKEEKSYLLAIGVPFMLLSCLSMLILSVVYLIRRKKKFAEVLEDWEHDYGPYMFKYKD
LYIAIKGFRVLGAGGFGRIYRGVLPTSKTEIALKRVSHESRQGMREFIAEIISIGRLCHR
NIVSFSVTAVERVLDKYLYNQPKVTLNWSQRFRVIKRDGEKVVIHRDIKASNILLDSELS
GRLGDFRLAKIYNHGTDPQTTHVVGTLGYLASENTRTARATTRTDVFASGAFLLEVACGR
RPIEAQEKEDVILVDWVFSCWDKGDILKARDPNLGTDLVAKDVELVLKIGLMRCHLKPTA
RPRMRQVVQYLEGDVTMQELLSLDESWAWYIKLKAHFIDPK
Download sequence
Identical sequences A0A059A6W6
Eucgr.K03098.1|PACid:23604774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]