SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Eucgr.K03103.1|PACid:23604778 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.K03103.1|PACid:23604778
Domain Number 1 Region: 23-264
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.45e-58
Family Legume lectins 0.00015
Further Details:      
 
Domain Number 2 Region: 279-347
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00000000000765
Family Protein kinases, catalytic subunit 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Eucgr.K03103.1|PACid:23604778
Sequence length 350
Sequence
MLFVIVLAVSLLANTAPTHETGDFTYNGFGSVNLSLDGLAALTGNGLLKLTSVNQQNNSR
AFHPNPIKFKNSSDGAVHLFSTTFIFAIIAEYPALAGPRFAFVIAPRREFPRDRPGYDFG
LFNETNNGNSSNHIFDDNHVGIDVNGLLSVKYSPAGYTENDIPGFRNLSLISGKAKQVWV
DYDGVQKQIRVTLAPVNVDRPNTPLLSLSFNLSLIFKETMYVGFSSSTGVLLTSHYILGW
SFLVNGQAHRLDLSQLPRLPHKKKKQKKRRKFAEVLEDWECDYGPHRFKYKDLYVATKGF
RDQELLGVGGFGRVYRGVLPTSKTEIAVKRVSHESRQGMRQFIVEIISID
Download sequence
Identical sequences A0A059A661
XP_010039199.1.83385 Eucgr.K03103.1|PACid:23604778

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]