SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Eucgr.L00031.1|PACid:23605413 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.L00031.1|PACid:23605413
Domain Number 1 Region: 192-510
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.01e-82
Family Protein kinases, catalytic subunit 0.00022
Further Details:      
 
Domain Number 2 Region: 5-229
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.3e-32
Family Legume lectins 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Eucgr.L00031.1|PACid:23605413
Sequence length 556
Sequence
MVEFDTFVNTEYDTFVNTKFDPEDLHVGININSIFSKVHSHWDIKSHSGNATNVVVTYNS
TSKNLSVFWSFAGDPISVDKKSPSLSYQIDLAQVLPESVAIGISASCGGIGERHIINTWG
FNSNLDAVRPPSTNSPVKWAHYKIYRLFTFITAPLASLMLIVSAGSCLFMIKMRKKCEHC
ALTDMEKEIRALPLRFSYQELVEATSSFSQDRRLGQGGSCHVYKGFVNSLDRQVAVKRIF
TESEHSEKVFINEVKILSRAIHRNLVQFIGWCQEKGEFLLVYEYMPNGSLDNHLFGPRKV
LPWDVRYRIALGLASALNYLHEDLEQCVLHRDIKTANILLDTDFNTKLGDFGISKLVDPR
FRTQTTDVVGTYGYLAPEYFNERKATRESDMFSFGVVVLEITCGRRTYQDGEFHVPLYKW
VWQLYLVGNMLEAVDQTLDSSFDRKEMECLMMVGLWCVHPDPRRRPKAGQVIRFLQLEVP
VPELSPAAYEAPTFYQPSAPRIDSSSSSSSSQEIVHVKQDETSVPKPHSSTLSLGWRRTN
LGVSEMVPHARSFYSQ
Download sequence
Identical sequences A0A058ZW90
Eucgr.L00031.1|PACid:23605413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]