SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Eucgr.L02204.1|PACid:23606973 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.L02204.1|PACid:23606973
Domain Number 1 Region: 95-412
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.2e-78
Family Protein kinases, catalytic subunit 0.0000907
Further Details:      
 
Domain Number 2 Region: 3-135
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000323
Family Legume lectins 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Eucgr.L02204.1|PACid:23606973
Sequence length 451
Sequence
MTASLDMSKVVNQNSYFGFAASTGDNAELNCVLGWNMTVEELPQGTPAGLVIGLAVGIPA
AALALAGAAALGVWAWRRRAAARDPNIVGTLKSLPGMPREFKFKDLKMATGNFDEGNKLG
QGGFGVVYKGVLAAENRQVAVKKFSRDELKSKDDFLAELTIINRLRHRHLVPLLGWCHQN
GMLLLVYEYMPNGSLDGHIFCSPERQTLEWSHRYKIVAGVASALHYLHDEFDQKVLHRDL
KASNIMLDSNFNARLGDFGLARAIDNEKNSYAELDGVPGTVGYIAPECLHTGKATRESDI
FGFGAVILEVVCGQRPWRRAGFDGFQFLADWVWSLHRDGLILEAVDGRLGRDYAVEEARR
LLLLGLACSHPIAAERPKTPAIVQILSGSVDVPRVPPFKPAFVWPLASLVSEDKDTTDVT
LMASSSRSGSGRTSRYVSKEGDAGYNNSLPV
Download sequence
Identical sequences A0A058ZTH6
XP_018722647.1.83385 Eucgr.L02204.1|PACid:23606973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]