SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Eucgr.L02638.1|PACid:23607283 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.L02638.1|PACid:23607283
Domain Number 1 Region: 145-354
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.74e-49
Family Protein kinases, catalytic subunit 0.00031
Further Details:      
 
Domain Number 2 Region: 3-156,189-230
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000793
Family Legume lectins 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Eucgr.L02638.1|PACid:23607283
Sequence length 382
Sequence
MVEAWISYNSRACLLSVNFTNFKDGGTHEFGITSLLVNLSQVLPEWVPVVLSPTFVGFTA
TTGIYNEMHKILSWKFSTDSDDLPNPRRHGNLRVLVMWLGIFAGSLGGSLGIVWFLSRRK
WVRNEEDDVIALDEIDRIDDDFRKRAGPLEFYHHELALATNDFDEKGKLGEGGLGDVYKG
HLRKLNSDLAVKRVSRNSKQGIKEYASEVKIISQLRHRNLVQLIGWCHEKGQLLRACEFM
PNGSLDLHLFKGVSFLSWEVRHRIAQDLASTFLYLHEFGNQRILHRGIKSSNMMLDTDFN
AKLGDFGLAKFVNHDKGFKVVTLEIACGRRSIEQGSAEEYPVQLVEWVWDLYGLGMLFDA
ADPRLSKEFVREQMKCLMLVGL
Download sequence
Identical sequences Eucgr.L02638.1|PACid:23607283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]