SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|393201950|ref|YP_006463792.1| from Solibacillus silvestris StLB046

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|393201950|ref|YP_006463792.1|
Domain Number 1 Region: 283-451
Classification Level Classification E-value
Superfamily MgtE membrane domain-like 3.14e-48
Family MgtE membrane domain-like 0.0000206
Further Details:      
 
Domain Number 2 Region: 139-278
Classification Level Classification E-value
Superfamily CBS-domain pair 2.27e-33
Family CBS-domain pair 0.00000865
Further Details:      
 
Domain Number 3 Region: 15-137
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 7.06e-28
Family MgtE N-terminal domain-like 0.0000416
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|393201950|ref|YP_006463792.1|
Sequence length 456
Comment Mg/Co/Ni transporter MgtE [Solibacillus silvestris StLB046]
Sequence
MIEEKNDEVQYDEAFLRMLLDEENIESFREHFLVLHPYDQAQFYEEVGPDIRQIIYRYLS
PQEMAIIFETTEIEDDEYKTYLDEMDPSYGAAMFGFMYTDNAVDILNELDTEQRENYLEM
MDEETVDEINELLGYEEYTAGAIMTTEYVSVVESATVREAMRVLRQEAQTAETIYYIFVV
DQAHRLLGVMSLRELIVAEGDLYIRDIMSERVVSVKVTDDQENVANLIKDYDLLAIPVVN
ENRELQGIITVDDIIDVIEEEAEDDYSKLAGIADMDDNDAGPLRAAGKRLPWLIILLFLG
MLTSGLMGIFEATLDKVALLATFIPLISGTSGNSGTQALAVAVRGIATGDIGGKSKFRLI
VRELSTGLIMGIVSGAIVVGIIFFWKGTLMIGLLVGAAICCSIIVATLAGSFIPILMHKL
GVDPAVASGPFITTLNDVTSIIIYLGLATTFISRIL
Download sequence
Identical sequences F2F881
WP_014824608.1.32796 WP_014824608.1.55795 gi|393201950|ref|YP_006463792.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]