SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|393202369|ref|YP_006464211.1| from Solibacillus silvestris StLB046

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|393202369|ref|YP_006464211.1|
Domain Number 1 Region: 123-276
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 2.88e-37
Family Multidrug-binding domain of transcription activator BmrR 0.0000295
Further Details:      
 
Domain Number 2 Region: 4-106
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 2.05e-26
Family DNA-binding N-terminal domain of transcription activators 0.0000953
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|393202369|ref|YP_006464211.1|
Sequence length 277
Comment transcriptional regulator, effector-binding domain/component [Solibacillus silvestris StLB046]
Sequence
MEEKHYSIGEVSKLTNISIQTLRYYDQIGLFKPSYVDPKTNYRYYKDSQFYHLDIIKSLK
YIGVSLEEIKAAQQFTPAELLSFLKQQESVIEQQMNRMYEIQQSLYKTKRQMEEQLAIDV
MDTVYFKNEESVRILSIKTNELTPYYIPNTYYSSLIKTLEVENSLLSNRYGCIFPYQQYD
SLDELHYSHVFTPLITDRYITHLTTDMDVKTIPAGRYVCIAFIFEPDTYLTQYQKLYHYI
EEHQLQVLPVVYEIFMPLNYSPNGEDQFIVELKVKLL
Download sequence
Identical sequences A0A1A7LHN7 F2F435 K1KYP0
gi|393202369|ref|YP_006464211.1| WP_008406183.1.16583 WP_008406183.1.32796 WP_008406183.1.55795 WP_008406183.1.70781 WP_008406183.1.91521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]