SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0000_0366 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Esi0000_0366
Domain Number 1 Region: 235-285
Classification Level Classification E-value
Superfamily RING/U-box 3.09e-20
Family RING finger domain, C3HC4 0.012
Further Details:      
 
Domain Number 2 Region: 135-177
Classification Level Classification E-value
Superfamily PA domain 0.0000000562
Family PA domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Esi0000_0366
Sequence length 315
Comment conserved unknown protein [316] r:2095153-2100490
Sequence
MAAPETPPPTRRAQASERVAREVLNFMAAIERGESLAVELPLPPGAVGLGGAVGTNGGGG
GGRAAPALEQVVKDLPRIQVEENSWVLHQTVLRLTGGGAGSELSIEAVFAPFSPPPSEKV
LGPVVLSVPPTADKDLENEADVEGSVLLMDRGVCTFASKALRANAAGAAAAVVVQTHDVW
PYVMEDSKGEAEAGGGLNIPVCMVSKEKGEAIKAAVVRSAAEGKTIRAELSVSSSEKDCI
VCQELYAVGNTLVRLPCGHLYHEACLLKWLKLSNTCPYCRRELPSSNEAVERARRSRQAA
GGAGGEEEAWRTFFD
Download sequence
Identical sequences D8LBB9
Esi0000_0366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]