SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0002_0265 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Esi0002_0265
Domain Number 1 Region: 362-439
Classification Level Classification E-value
Superfamily RING/U-box 7.77e-24
Family U-box 0.0039
Further Details:      
 
Domain Number 2 Region: 173-264
Classification Level Classification E-value
Superfamily vWA-like 0.0000000181
Family Integrin A (or I) domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Esi0002_0265
Sequence length 440
Comment conserved unknown protein [441] r:1458077-1469361
Sequence
MAGGKYAQGEQHSRNGRYDLPAYGNTDSWHDDDMRVAVIVLLMALGWIYLKLRGKDANKG
WLEALGVGFGGNDPPGFASLEELVGALKDAGVSKAGLIVGVDFTRSNEWTGERVYGNGSM
HDIDDRKPNPYQEVLRGVGRGLGPLNRAEKIWCYGFGDENTRDEAVFCFMADDQPCANLA
QALDRYASIAPAVSLSGPTSFAPLIRKAIEIVQDTREYHCLVIIADGQVTKERDTVRAIQ
DASNYPLSIIMVGVGEGPWETCREFDNRLPGRRYDNFRFVEHRRLKYGDAEALALSALAE
VPDQYRAIRALGIMEGAGAPGSGPTSVAASVAGGGVSGSAPSMAPVNMVMSGSAPPSAPP
SELDEDEGVPQDFICPLTLEVMIDPVVCEDGHSYERGALEAWLRNHDTSPMSNAHLNSKM
AVPNHALRNSIEAFRRERGY
Download sequence
Identical sequences D7FQB4
Esi0002_0265

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]