SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0002_0298 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Esi0002_0298
Domain Number 1 Region: 1-47
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000326
Family RING finger domain, C3HC4 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Esi0002_0298
Sequence length 205
Comment expressed unknown protein [206] f:1627084-1630146
Sequence
MCYDLFVDPIELDCKGKHLYCHSCIYDLVKNGSCQNKCPICMTSISSSTRKKILQAGRKR
GASGMPVGANKRYQSQAVGLVQEVIEWLIEKRMVKYDDETEWRKRSGLEPLPPPKPAAGS
GSGGGGDGGGASGGGGGGGGGGGVGGGRKPGLPVPFGNTTGGAAAARSAHGAIFSGGSMG
GGAADVIDLLSDSPAEDDDDGYSDF
Download sequence
Identical sequences D7FQD6
Esi0002_0298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]