SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0006_0132 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Esi0006_0132
Domain Number 1 Region: 676-864
Classification Level Classification E-value
Superfamily Sec7 domain 3.66e-64
Family Sec7 domain 0.00000382
Further Details:      
 
Domain Number 2 Region: 1268-1541
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000378
Family GUN4-associated domain 0.04
Further Details:      
 
Domain Number 3 Region: 22-87,177-283,378-552
Classification Level Classification E-value
Superfamily ARM repeat 0.000000893
Family GUN4-associated domain 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Esi0006_0132
Sequence length 2176
Comment BIG1, ArfGEF protein of the BIG/GBF family [2177] f:765813-793666
Sequence
MEAIVVRALTKITTDCPRRQSNLKRQCRDTLEEIHRNDEEERLEDETPDTDANKYMPCLL
AACSSGVPKVVTTALDTVVKLIDYGYIRDVEIDSDDEDEDDIDEVVQLQEGAGGDAGGAA
DEDDEDDDAAGADAEGVPSTLDPSLDPPSSSAVVHGDPEVPPPSETVEGEGDDKGRMLMD
EVVERVCDCDLETEDVQLQVIKALVHACTATTLSVHRASLLTAVKTIYTVHLSTHDSINK
NTAKASLQQMLSVVFSRMEAKDAQLKEEAAAAAELEALRESDPLNYPRPPPPEPEPEPQP
EPMPEPVFNIPDTMYKEVAEAMEMPELYKTVPELPPEEVSARRKRYRRALRGYQRRQWEA
TTVQPFASVEHEDAFLLFRALCKLSQRPDHAGTGDGLAVAPTAEEARQMESKAVSLEMLL
TIVDNSGPGFRGSEKFILAVRHYLCEALLLNSTSSNRAVMELSLKIFKPMCRDFKAHLKS
QIEVFITTVFLRVLESENSTFEHKRQVLDVVTAFSDTPQALVEIFLTYDCDLHAIDLYNR
IVNALSKISKGRGMSNSDVSNNPGLLREESYLRKKGLEGLVSILENMLSCVASDVSADMQ
DHGDVLDGNRQISGDIGGDNADSNGSFGDTLGSTASSVIVAGGVGGEQGELDMKQSPVSV
VQEYDRKKKLAGDLGNGFVRFNLSPAKGVSYLVEKGMLVYEPRAVATFLLENCDKLDKTQ
IGEYLGKEIHYKDGFCVQVLHEYVDMMDFKGMRFDDAIRHYLSGFRLPGEAQKIDRMMEK
FSERFCLQNPTVFPSADTAFILAFSIIMLNTDLHNPAIKEERKMTREGFAANNRGIAAGG
NLEESFLNEIFDHIRANPISLKEDDQAREKGETQTGAASAFPLYFTAGPSLRQKREAFNK
EREDMIKDTEALFRLRKKQASAAKAQALAKAAEAVAAAKAEAEANEAEGRVPGAVKAIEA
KLAGGDGLPPPTVAVALRADSASEGRRDVVRAMFEVAWWPMLGAFSQVLEDVDHIERTDS
TTEEQDAVESEMVALCVKGCRFGIRLGSLCSRWAGGEGEGSIARETFVNSLAKFTLLDTV
KEMRPKSIACVRALVDIALEDGNFLSESWGSVLRYISQLARLQLFASGLHTDDHFFTSEV
GGGGGGGGAGGIGGIPGSSTHSVMRDQQQGGGRSSSVDGGIAGRMTKSGMFTRVNPTEQA
RDVERMNAEAVSLAVDPAMIDRVFSNSPSLSTEAVKHFVMQLCAVSSQEVNHSAATFRSK
DILGDMSQPRIFCLQKLVEVADFNMDSRGRIVWAHVWGVLGEHFSKLGAHPNRYVAEYAV
DSLKQLALKFVYKKELEGFNFQRLFLCPFEAVFVATQHKEIKVLVMDCIQNLVQARSAHI
RSGWKSIFSVLALAAKDGSGGLAFPQQSWGVLSRLVDKEMHSLVHDFLDVIKCLVAFVEG
PDTDLALQSMEKLKACAEHLVTGDLHILPPALHGHVSTGQSAAADAVAAAAESGNAGQEL
VYLQLWWPLLFGLSEAIGDPRPAVRSSALSALSHILTEHGAIFSAQTWGLLFRGVVNPVF
ENAITEPTQPLSSDWPGQEPGPLQVAAAAADKAEEDAVARAAEEKAAEEERAAKKAAVAK
GYGGGYCRPPRPSSSGGLRDKLDGYHGGAAAGAVPRDLLQRCICQESEVLARIGLTSLGR
FVTAMHKGFSDASETITRPKATAGGEDGWAANGPARGDADDKYTIWDTLTSSLCAIVQDN
LPSELVDQEYNIDEAEEMPPIASAADDNTLTTAEEGQGNTNAASSSPAWIDTARPPTEGG
SPRSSSGESSSSSSSDDGNSARREESESSWGELQDARGDGGGAAESSDVPGAVGNDEADG
EKREEWGAADSEGKNGEGPGREEGDGDEKKEGGGVPEVELETPPPAAAEGAVVDDADVVM
VSPRGGGSGHGSSASVDFDGATGGVTRHPNLRALMTMLVVSLRMQRLVHWVVRKRCLDGL
SANNLVDLLAALEAASVTALKFNRNHNLRRALGRVGFMASGQPVALCPMLEQEVAGYNLL
LQTLVVLSRGLDVDSGEPVEGGAGWPFAQACLVQACKCVVLAYADREEHAMGLELTLPGL
DHSALVEEVKQTTPLVIFALGSMMYISEEQVRLNVGWMYGCMTRLVRCNSEEVRHHVQQI
LIYKMGPAMVPQSRAP
Download sequence
Identical sequences D8LQI7
Esi0006_0132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]