SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0009_0146 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Esi0009_0146
Domain Number 1 Region: 271-335
Classification Level Classification E-value
Superfamily RING/U-box 5.3e-21
Family RING finger domain, C3HC4 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Esi0009_0146
Sequence length 556
Comment conserved unknown protein [557] f:923997-931714
Sequence
MKFGAYAGVSFLVATTAVIHAWQTRVEYYPTVVFLTTNKLAQAALGNWAIVMAIGMGRLV
SMLFLGPLRDIEIEVMYENARYAFTETCLALTVFRGDLTAVTIALFIQLLLVKAFHWLSR
ARVEHFEQAGQQSLSSMARLCSLVFITLVVDGLMVTYCLENIPVDQVSSLVLFAFEYAIL
SIAAFSTAVHLLLHVVDNRMEGAWHAKATWVMLLEFFSEVFKFSFYVIFFGVMFSLYGVP
PLNLIRDVYMSFDRLQRRLQAFYRYRQLANTMDERFPDATEEELAECEHTCIICRDTMDA
GKKLPCGHIFHFQCLRMWLQQQQACPTCRANIPAHVTVAAATAAAERVEQGGARAPGFAA
LGAGPVGTVDGGDGGGGALFEMPRAADGVGAASGGSGGDGGVQAGFGAFGGGGNVAAPAP
GFAGLVEGGAGEGGEGGGARGVLKAVFVISPTGARVRQGLKQGTATVRTEPSKSVLLLLA
PPCSCGSLLVHGGWVGGPGNEGDVRLVEIGQSALGGSGGATPTPVDEMLDGPEAVGGGRE
DGLRRRHRGVLAGADS
Download sequence
Identical sequences D8LTS9
Esi0009_0146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]