SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0010_0144 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Esi0010_0144
Domain Number 1 Region: 376-418
Classification Level Classification E-value
Superfamily RING/U-box 0.000036
Family RING finger domain, C3HC4 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Esi0010_0144
Sequence length 423
Comment expressed unknown protein [424] f:838499-844785
Sequence
MPDNELEAAKGLHVEDIDCSLVVRPTRTALDLRFFGEVSYSFEIVAARLVRPPKRPPDAR
SGRCRNKCSPGKACPCNHDSPARSRRLAEDVEPPGKTEVALSVPEGDGEGQEGEAGGGGE
GGGVHPHHSLNMGVNDVATLVLEDNQGITYDFYTFQVVEFDADSGAMALDRWNLFHCGVF
RYSCALENISKVEITEGNVYMMSAHAFEHLRQTKEFGLRVIFSVPLGASQAATAHPRSPR
PNNAGMNFSDPGGSSPSSDGDGISAVSGTVGGAPVARAAARRAAGAPRRRRWGVLFRRLL
LCGRAGWCFGGRGWWRRPAARGVLSTSGELMYLNLLFGKKELDDRNLRRPVEMVNELLLR
FANDVEVDVGEKKEGNCCVCFRRRSRVVTFPCMHMATCPQCSESLTVCPLCRANISEKHT
VFL
Download sequence
Identical sequences D8LC33
Esi0010_0144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]