SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0018_0084 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Esi0018_0084
Domain Number 1 Region: 1039-1112
Classification Level Classification E-value
Superfamily RING/U-box 2e-22
Family U-box 0.0037
Further Details:      
 
Domain Number 2 Region: 1169-1271
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.00000000000249
Family FHA domain 0.0034
Further Details:      
 
Domain Number 3 Region: 1404-1501
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.0000000000325
Family FHA domain 0.0051
Further Details:      
 
Weak hits

Sequence:  Esi0018_0084
Domain Number - Region: 848-896,951-1016
Classification Level Classification E-value
Superfamily TPR-like 0.000835
Family Tetratricopeptide repeat (TPR) 0.021
Further Details:      
 
Domain Number - Region: 256-335,369-468
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00337
Family Gluconate kinase 0.078
Further Details:      
 
Domain Number - Region: 255-298
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00637
Family Gluconate kinase 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Esi0018_0084
Sequence length 1540
Comment armadillo/beta-catenin repeat family protein / U-box domain-containing protein [1541] f:464752-476058
Sequence
MSAAMENVTPRASSSDNGSDSDGFVVVSDQEDFVKLKSPPRPRTAAVAAPAIAPSAGLDE
PGLTVGIGSNGGGGAGAAPHHRNHQPATATSPGELVSSINRSPAVATATTTTVATATSAA
ATSANIVSPSSPLRPNHPCRHHHNQQNSPPWTRVAAVPPEAPRLPSHYVERSALLENVVN
MLIAKKHFDNGHARGVTTTNSGDNQLDNNFPIRNNGNNGTHVEKRCKTFFPRGTKNTSGD
GNGNENSNDDDGLEGAAYALLGDSGSGKTVLASAIVSHPEVRRKFWRGIFWVNLGRGGVV
TRARTGTGGGLLRALLHDLAAQVVALDHPLPANGEEAAAATALLARSASAGETLKQLATS
NGGSHVGELSRLLVLDSISESFTDNPNAVAELERAGFTVLVTCSRPCALSVLRSKQPMAK
PEVGVPGGLPNDLEHGHRTSPHRRIHVSVLHPATPSEAVEMLLKRVRRPGGATMAVEATS
PAGWAELKAAEAGGPGANASTRASFESCALQVVNHCREVAPLALAIVGAVIAGQDERGGR
RDNSLSCDYAERCRQIERQVTRHQDCGDGYDAFNRVMELGFGALPGDKTKDCFIRLGVLA
EGTVAPLDMLSNLWGQDSEETARTVNELSENSFLIEMDPGSRCYSIHDRVLAFAKTKLLR
AGFGPDGFHCRCYLGGEKAAASTTARSTREAAVVNQVDYLSRPGILSRFSYSGGGSNGVI
GDGGEAGIALGCGDGMLLGGLPALAALWQSLEDLRSDDDCYCERFRIVMGRRQSPRRRFL
GDAYGASLQRMGVCVEAAFGYWAAAKLLQLQGINKDAKTMAGKSVHVGNALYHAGAAQAE
RLPSKSTLLRQKGKDNKLVDRYEKEVESVRLSYGYHHPAVASALSSLAHVLLEQGKTIPA
GVRYREALVALEGSVGDDHPLVANALMDVAKADTNQLMPLLDGDERRLLLNTHSSELCSR
ALSIYDDDLGLAVIMFLRENTTPLVRLAHMLEEQGNVKEAKRLCRAALHTLDGENPLGRP
QVAAVLATLADLLGKEMHGFTLRDAFACPITGELMRDPVVVEDGHTYDREAIEMWLRKYG
TSPKTGEPIERLLLVPNLNLRRLIKDFLIEGGEELYVGGRDGDGGDQDDGSGEVDRDEGD
GGESGWEERSGTGEHRECRFALVTEQILVLKCLGSVYPGGNIESFRVTERGCVGGRNQPN
TLAGAEFVQISDATVSKRHFGIAFDKEDKLFSLRDLGSAGGTFVRLELGVSTLLYPGMII
LLGRHQLEVIDVSSTDSEAKAVEGDRNPFAVGDKGSNATSPSSPSAPGNSSSTAARRRGM
ACSIVGSAAIVNKGPTTDGGEREPRHPISPQPAKSSSSKQHEEGEGGISDDEKELEAGAK
PGRRNPRVCLECFAPEGTPIQGKRFFVGREGATLGGRKTNTIAFSYESGGTVMGIDDFIS
GVHARIVYDDGGGFFHITDGNSFKSSKNGTWVRLSGKHTESRPYPLSHGTEILIGTVPFS
VTLGRLKKSSPPKAEVTSCREGSGPSILAPAGSEPRRQSS
Download sequence
Identical sequences D7FNJ7
Esi0018_0084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]