SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0021_0147 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Esi0021_0147
Domain Number - Region: 836-893
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0339
Family B-box zinc-binding domain 0.0097
Further Details:      
 
Domain Number - Region: 758-802
Classification Level Classification E-value
Superfamily RING/U-box 0.0742
Family ZZ domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Esi0021_0147
Sequence length 1417
Comment hypothetical protein [1418] f:810241-816168
Sequence
MLFPLTFKSVGLARAEAKQGLDVYWGEALRRCWREGNGRGARSLEELSPALVYREVAVCR
ACYDVYRRLDKLRERGGGRTADAAGDRGSCSSSSSSSSSLPLPSSKGRRDSLAGIDATAS
SGRRAAAAEAGAVTLREEVGEMLKDVDARAGKPGVEAGIPWRRRLSKSKSTAGERVDQSR
LVDKLSRPKKQQLHHPAEEERHTLPREDHTARRPTLKRQVKSQGDIPDSAGDAGDRRHHP
QRRTSAPVPGGGFPSLTRARRRRLEPAAPVRGAPWQRTALPRGKKSAWPPLDDEGGEGTV
ASDHHASNPFGRYLEGSGGGGGGSGRSRETICAIEAMLEEGGGDSYLPARARDLPEALAV
LGPPKPESSSKDKARGSTARKKLRHRGAGKKSGEDPERENNGHGTGGEESHRTTRDALEA
SAENGSTGRSGNDPGPNTGGEGHTRKTSPGWPSAKPERAEERFLHPWQRALEADKRAVNA
RTGGQHEAALLEEQRCRREARRAAAESKDCRRAGRRVAARLGRQHGRRGRRHRSGKSRVH
GKGDRKMAPDRPEGSESRAKLNGQGYEVSSRDREVVLHRCGGDEDDDDSLRQLRDALGWA
RKTLEALMKRLKDRGIAIESARAAAARGGGGLGGAAKDWEIVRVLNKLRRRVAAFEDEGI
SLGVNKATTAEEGVAGAAEARSKCEAACESFEADFCHLIDELTATAKGLPSHPDLQLRST
SITHWASESSGSVPPGPGGAAASDPASRTTFRSLSFGLCSSCSVLPVARRCLDCDGDDRD
RCSSCFVREHRDADRQRHRFLRISGCGREGGGTVAGPRRGAASAEKGAVQEDSSGGGARC
SRCGDLAAARRCRDCSVDMCAACHFLAHRSPSKRSHVTEFVGETAVSMQEALQSRNWGAA
AGSAAAREISNDGGEVAAKESGASSSSSPFSSPSTPQASRNVGNSGSDRVDAVSREAREG
WGRESPVPGEGSFGKGAAQSLAQVRRTIDAPAVPPPGPSQSLGGIGSGLSGATEHFDGVG
GESEDVSRDDARPIDVDPSAEVGVGGSTSLTDGDHGVHPRFEPPGDDFVEEEAAIPNGDG
SPDEVIHRDGAGHYGGGGWNGWEEGQGRDERGNVDVEIPEEITGGDGEHGPSDSATHSIN
IKDDGRSRDTLRAGAGGRGEGADMAEDMFGGLEGIKEEEGLEGEETDTSSEEDSDNDDDD
DEGMMWSPVNIAKVVVPDTASDDEEAEIYSPPFTSRAARTPDELDDIPATSMEEGEDRGN
SQAAQTREATTPKIAKTPGPDEVTVNGAVGRRELDTSSPPPPPAATPKGEAATIDLDFAL
GSRKRNEEREGHGGGGDASPKWTLLLQTGAPKDEVAERKPDGKSTPPPPAAEIMQRADGP
ERTDHQETVESGCPSPQEAVSQNTDTSAVEADESNCR
Download sequence
Identical sequences D7FR03
Esi0021_0147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]