SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0022_0138 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Esi0022_0138
Domain Number 1 Region: 206-252
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000459
Family RING finger domain, C3HC4 0.0059
Further Details:      
 
Weak hits

Sequence:  Esi0022_0138
Domain Number - Region: 108-169
Classification Level Classification E-value
Superfamily RING/U-box 0.0235
Family RING finger domain, C3HC4 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Esi0022_0138
Sequence length 259
Comment RING finger protein [260] f:763018-765481
Sequence
MVDLASEAASLGTLDGSGRNVGGPQQQQVQGPYQSGAGTARKRKRRQQDEVVLLDDAAAA
AAASTAAGASAGAGASAAAGGSDQAIEVLPRQGKAPARKIRRKAGWSAVTCIVCFEDTAV
DRCARCPEGHAMCKTCVKSYVTETLMPQGTVFWDRIKCGGSSTCGHLFGPSVTSLLPRPI
IEKIETKQMDVAHLVAGERDPTSDKWISKHSRDCPNCGVPIQRSSGCMHMTCIICRHNFW
YGCDCKYPRHQQGCRKRLY
Download sequence
Identical sequences D8LIJ1
Esi0022_0138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]