SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0028_0149 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Esi0028_0149
Domain Number 1 Region: 411-599
Classification Level Classification E-value
Superfamily Sec7 domain 1.96e-61
Family Sec7 domain 0.0000106
Further Details:      
 
Domain Number 2 Region: 613-723
Classification Level Classification E-value
Superfamily PH domain-like 1.9e-20
Family Pleckstrin-homology domain (PH domain) 0.0018
Further Details:      
 
Weak hits

Sequence:  Esi0028_0149
Domain Number - Region: 783-904
Classification Level Classification E-value
Superfamily PH domain-like 0.00863
Family Pleckstrin-homology domain (PH domain) 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Esi0028_0149
Sequence length 1084
Comment pleckstrin homology (PH) domain-containing protein [1085] f:830660-841065
Sequence
MPTGCIHHSQIHSSIDLVDAASSGSVTATRGGAAELTDEEGEVGPAIGMGWDVEGGQVLK
PPRNSSISTGDACIGCPAADGAQRKPSIQSPQEASDAALFQHHHACGGANPDNIPGDGPV
PLAPFGTSAISIRSGSAAAGVHMHKRGGGGMELEPEAVVVTPLASAGAGDVGAEHDATPL
QSRHKGSARSGGGFGSPRSSSGGGGGGGGGDARGETASDGAASVSGVDDSLSSVGEGPGG
LKRKDTITWESFLANITVTDEAKEAGGGAKGAEAAAGACSDSSPPVAMRLTSGAASEGVK
GLLGSAAEQPLTARTRYLRAMASNAGDVRWNDDLDDEDRNDDCDGDGDSDGDTESAGLPE
LSEGQLVHRANVQRLLSDLSDRTFSPRARHPVDLGRSQSMSSVGMGSINSVRKIMERGVN
KFNVNPKDGIAYLIDNGLVTDSAQGICSFLCSAEGLSKRRLGEYFGRDNPKAQEVLRLFL
KELKFKNASLDEALRAMVMRFRLPGEAQQMDRIMESFAVRYHEENPYVFSCSDTAWVLAF
GLMMLNTDMYNRNIKESDKMTEAEFVKNHRGIDQGKDPAKELLEGMYRRIKASEIRMAEG
DMYESEVITFVAPKKSGWLKKKSTGYVGKWKRHWFVLNDAVLYYFLAPQHQDEAPRCIIP
LEGINISPIGATDLSIGLRTNQGFVKSVKMADNGTMQQGTHRSFTLRADTNSERDIWVDA
LRAEVPAFHMELSASRSLSATPATSSAPTPIGTPSESGRRSGKFSASGRTRRRATIDLEA
SSKMQPPVIRGWARTQSDQHQSGGRRYIALFRDIGPDQQDNVIYFFGDAAMCDKMIEQHL
RTSHGSLNLSDVTRVQLQQEEGGGGGRAIALQTGAGKHVKEVVIVPEEQREFLAWTRNIK
ECCPGSAYSIAADCTPSASVGATAFPSVNTVDSNGDGVASSVSVSVNSAIAIADHIGLHD
PPAAADDVFVSVGIPATSTTESVAGTADGKGQGEGAAEGSELHTRSESSVTQPVDAAAAA
GAGGTGAACEVNRVNTTPSAETEAYGRFEHHAVSASAPEPQSPPRVGSASRIVREGSMPG
TDVE
Download sequence
Identical sequences D8LK46
Esi0028_0149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]