SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0029_0056 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Esi0029_0056
Domain Number - Region: 533-562
Classification Level Classification E-value
Superfamily RING/U-box 0.000111
Family RING finger domain, C3HC4 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Esi0029_0056
Sequence length 658
Comment hypothetical protein [659] f:300073-305662
Sequence
MEIGTTNCDGGEQEWLRPAVPASRPTAPTESKRTSVLKHRTFAPKSFGRNKAPSGEGGKD
DIEIAKDDENFRNGLKRNIIHLSNLTRVNQEQLARLREQLKAKDHEIASLKALKENVRQE
DRQQDPPEKGPGPSERTNAGRCGPRKLVTYGKMVVTAGRLASEPRQRPEKAVAQPSEKET
LETERAVAAMGAKHTEQQLLRASRDVRGQLERALQEAEALRADNIAFKTRVNVAEKEKAH
LETRVALLSDEVKLQIAPLKALQLELTQTRSDTETMRQRLKEERRESRLRVSDSDKAKSE
AQQRIDLLEFDLNETAKACQRESLKASTFEGMYQEASTMATLLQAEVEQCRTDAKMIAQE
LTRMQIESEKSSALVGLTPSLALSSPVDVGRAVGGVDGKEVTTGKLGEEQEAEIASLKKI
IAQLASEKSDSGDAMKNLLEAHRREGEERERAFKEMQKKADSFAEENIGLRATIEKQEEE
SERQRVEEDERHDRDIKREIILSQQNLDSASLRDRLCRTVDELCGAEEAGELVLTCQRCA
KLFKDPHTMAPCGHTLCAGCCAGGDGGMSAEDGTGRVPGGSGESPGSVTHAEPECYLCGQ
QGRGATDRVACVGMAPNRALASVVMKFAFRRQLVQTLKEIGAALSGQGSVILDSVDGV
Download sequence
Identical sequences D7FVA8
Esi0029_0056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]