SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0029_0140 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Esi0029_0140
Domain Number 1 Region: 701-901
Classification Level Classification E-value
Superfamily Sec7 domain 8.37e-59
Family Sec7 domain 0.0000174
Further Details:      
 
Weak hits

Sequence:  Esi0029_0140
Domain Number - Region: 402-598,763-804,1194-1231,1266-1301,1336-1384,1567-1680
Classification Level Classification E-value
Superfamily ARM repeat 0.0265
Family Armadillo repeat 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Esi0029_0140
Sequence length 1919
Comment GBF1, ArfGEF protein of the BIG/GBF subfamily [1920] f:873471-892603
Sequence
MASSVNANAVLCVKGEIHNVLTVLRLNSRWASRERFTREIPLQAESPLARAFKGLHSHLE
EVDDLANVDTVRYLLPFLAVVESPATTGPMTGVALSSLHKFLLYGFIRKDCPRVKEGITL
VAQAISRCHFEETDPESDELVLMKLLELSALCLRCEVGDLLTDESCWNIFVACYNLYHIT
TDDKSFGLLRDTAGNTLAHIVLMLFSRPRVSRASKSAAPGGAATADATVAAGGAVLHETL
GQKAGAEARDCPPTEPSKAPPTPGGDRDGLAQASPPPPAAAGLWRHGSSSKAGDEEGSSS
GKQTPFGRGRGVPPPLEGGQEEEPWPSLDGANDDGASQGVDDGVVVAGRGALKAMMGPGN
GRFGLGGVGGPVSPVQPTKHGGGRDSGTAEQEGVLVKLMRFLSLLSDPRSNGSAECVLSL
SLINIALEAGGADLGRIPSLVRVMRGDLCKHLLQNSQTDDLDVLSLTLRVVFNLFNSIKD
HLKVQLEVFLTSVHLRVLDGSSYGPEQQELALESLLEFTREPALMTDVYINYDCDVQCTN
LFETICHSLSSHALPRDGMEVNALNRLALEGVLAVIESISRRCGPSSKPPSSSQQLGFWV
QQAGGGGGGGGAPPLPLSGPHSGGLSASLGGPDSSRRGSVSDSDSDQEYIAAFGGGGAVH
GRGDGGGAPFAGSGGGGGAAGELGWLERARARTAEVLQGRKKMKRRLGLAARKFNTGSKG
WLEYAQELGLIPTPKTAAATAAFLKGTLLLDKSMLGEYLSRGPADKYPFNAQVLEEYVKL
FDMRDKTFVEALRAFLKEFRLPGEAQCIDRLMEAFAGQQYEQGKDSGQHPFVNADAAFTM
AFSAIMLNTDLHNPQIQDHRRMTLDDFIRNNRQINGGKDLPREFLEDMYTSIKENEIQVH
RDHVAMAADGLGIDYTVHWDGILNRSNNVASASFTPAQAARKHLFPAGVHERDMLLSVTG
PASDAIRAVFLRTQDDLLVLGCLRGFRSHARACVYLGLLAPFDAALVFFFRRGLEYASSA
AAGAAGLPLPEVLKNPGLPDVTDMAACAPFASGCVLHRDLLALKCGLELARAYAHCVSTA
WGPMLECVFALADLQALPASLTDVDDFGDAQGNPLPPSVFAKRCRDRARSGHNVLLSQSG
RVRAAAAASSGRGGGGGGGGSGGGGGGGLWGSLSGVLFSRGGEGDGGGGRRGGTAAEAAI
GAIAEVVRTVQLEQLFPQTKDLPLEVVEGLLGALLTIRDPATPRRPPSNGAGEAESMAVV
AAAAAASFEAHAVLALELSSRVVLANRQRVPSLWPALHSFLARVLGGEDSVTMTRMPYLV
ERAMVTVLRACIHMFDREDMGAMLLQSLKLLLSLPPDVVLPLSNRLASGLLILIQANASA
LSLPSTAVQWEVISALMGKAVLGGGGRGFILEALAFVVNRGLGLLGRHNVVSVHALLTRF
VRGDFSDGKADFAWTLQACAALEAMTFALLRDLHTSPPSAAAAAAATVAVPHDINNKDGD
GAAKKLPQRQWTIVDDDAAAGGGVDEGGGVGAGGTGGAGAPGTESVGDDGAADTAGSILS
RYEAEGMWLSTLQTLGALAGSHFPKVAKGAADALERLVLELHGVGAPAWGTAFSEVLLQL
PVPLLPPHFRPAAGVVVQGTWSEEVCIRCCSILSRAFLHHLQALTSLPGFGKLWLDTVTL
ISRNLEANGSSGADGVAAESCQQILTNLVMVVAYAGLLGGQHVLGDTGPGDASGGGGSRG
GDPQRLLHETREILEPVCPGLRPLLKGLAGTGTTTPEALDSQPPPPPPAAEPPAEPPTEA
PSSHEGLGDGSDVTTAAPEVEAPSFPERDADAGGADSVLDYGGDGSLAVDEARGVGDPWS
SSPANDDELQAADGLFEDKGAAGGGERDAAAGAREVFDRPVVQSSPAPPILSGGRPQIV
Download sequence
Identical sequences D7FVF3
Esi0029_0140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]