SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0032_0056 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Esi0032_0056
Domain Number 1 Region: 763-833
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000113
Family Eukaryotic type KH-domain (KH-domain type I) 0.0016
Further Details:      
 
Domain Number 2 Region: 890-942
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000101
Family SAM (sterile alpha motif) domain 0.019
Further Details:      
 
Domain Number 3 Region: 190-223
Classification Level Classification E-value
Superfamily WW domain 0.00000786
Family WW domain 0.0024
Further Details:      
 
Weak hits

Sequence:  Esi0032_0056
Domain Number - Region: 964-1010
Classification Level Classification E-value
Superfamily RING/U-box 0.000362
Family RING finger domain, C3HC4 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Esi0032_0056
Sequence length 1018
Comment conserved unknown protein [1019] f:289700-299587
Sequence
MARTNTSTPVPHAAEALQTKPPPAAIPQPTKPAAAGVAESAISSRGALEEKVPAGAAGHG
EGVWGAAVGESADESSLLGASVLRMLEQARKALGGGGQGGRRLPVEHVREVVAMWEEEEE
EEEKGGGLARGRRSTLRGVTSVETVRALFYGWVESDVVDLYHGGSEDVRQTLKQCREAME
QVVANEHAASAAGAWTMYTSPDHDNRPYWHNAQNNETTWENPFEQQQRRLREVQQAQAQP
RGAPAAAGGGAEGGAESSSSASTTVSQLAKDIDSMAASWKAGGFNHDRFTSWMGRALRTR
SEIRTRREEGKSGGGLPKFSAPVQDSPRGATNDVRGPLAAWPGSSVATREAVQVPQAGAA
AAAAAAAAVGEDRREMAGAAAASGGAAARGADGGGAAAGGAVSVARAAVRSSDIPRAATG
REQQVPWPAAVETKKVPAVEAAGLKTVGQETAAAAAVAKKPTAAKATEQPPQQQQLLKTG
ASAGKKEVGAAAAGAVGVATLEAQMADLQAAEERQQAAKAKKAARRAEEAAEREDRETQE
AVARKEAAARRREATAAGAARSKAEAAARETARIAEAKAATEARVMAAVAAQAKAEKDAK
EAAKKTAKESADLQQANRAKRQERAKAVADAKAANEARAAEKAQREEKEAAAAAAATAAA
AAATGPAMRGGGVGGGGALLADMSLEVRLKKAIDSGNTLAVQSIYDEADQTPGASMKKIK
KKCQRYLNKKAGEDQKLQQASQPAPVRGAGAGAAAAQAAAAQRPTQHDMFCPNNIAPQLI
GKQGQTVNKLMKDSRAKIVVKPYPDRSGNDVIITGTPNAVKTAKRLVEEFYRSKGCQPSA
LPPPSSAVAARKAEGARARPAQPVTGGPGGGGGGGAAPVVVEDGAWGGELRQLLRVAGCE
HHLERFREDQLDGEVLLMMDRRDFERMGVTEGEQIRILNALKGSGGGGMDDDDEDSDGLD
PDHPDTCKICLDALVDILFLPCAHQCTCSRCGSAYEGKPCILCRRVVDKVQRVIKLRG
Download sequence
Identical sequences D7FX21
Esi0032_0056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]