SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0035_0116 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Esi0035_0116
Domain Number - Region: 69-92
Classification Level Classification E-value
Superfamily RING/U-box 0.0653
Family RING finger domain, C3HC4 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Esi0035_0116
Sequence length 117
Comment conserved unknown protein [118] f:594773-595478
Sequence
MDGFERCHCSIFHVLPGGLYLEHQGVGLAQYMFATFLPSQSCRKYLKLRTQQSVDFRAAC
FCHKRVVDIAYVCSVCLSVFCEFSPVCTTCGTRAWPKKIKRGRHKALAGTTVANGRS
Download sequence
Identical sequences D7FYW4
Esi0035_0116

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]