SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0037_0046 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Esi0037_0046
Domain Number 1 Region: 309-454
Classification Level Classification E-value
Superfamily Cyclophilin-like 2.78e-57
Family Cyclophilin (peptidylprolyl isomerase) 0.00000227
Further Details:      
 
Domain Number 2 Region: 37-107
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000017
Family U-box 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Esi0037_0046
Sequence length 556
Comment conserved unknown protein [557] f:273812-285209
Sequence
MGRNQHSKDRLFLTATEWKRDYGGKKADKNGASRPLAFDCCALSLAPFETPVCTKEGVIF
DILNIMPYVRKHKKNPVTGEALTPKDLVRLNISKNADGKWHCPVTFKVFNDNSRILAIKS
SGNVFAAEAVEELNYKAKSWNDLLTGEEFTKRDVIKLNDPGDKEFVASRDVNNFVHLSEV
REERVAELAKVAHADKIRQTKSTELIFREIGAKRKRDAAEKAAKDEEDRKTAKEREEAGL
AAGERLWKRGKVTTEDLVGGRIMTSGKTSGSFTSSALAVSTESKARLATDDEINDARWYR
LRKLGKKGYCQLQTTKGNINVEIHCDIVPRMAENFLGLCEKEYYDGTKFHRSIRNFMLQG
GDPTGSGRGGESYWGGKIKDEFESRMTHDKRGVLSMANSGPDTTGSQFFITYKSCKHLDN
QHSVFGRVVGGMPALAAIEAVPTDSKDKPREDYRAGQGDGVQQPRHGDGGRAGARAAGQD
RRARSRGGRKVDKVRTARPRPRPNRLGKQPDARSTAGHQDRSGKISRSRSRDHPAPLGVD
FVGRHDAGRGGKSGRS
Download sequence
Identical sequences D8LLL2
Esi0037_0046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]