SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0038_0043 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Esi0038_0043
Domain Number 1 Region: 3968-4010
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000105
Family ZZ domain 0.0087
Further Details:      
 
Weak hits

Sequence:  Esi0038_0043
Domain Number - Region: 4866-4877
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0497
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Esi0038_0043
Sequence length 6622
Comment conserved unknown protein [6622] f:237770-279111
Sequence
MLSMADYAAGELWRLESVSGRGSGQGSTSSSSAAASGGVWRNLPPGAVDGLSHGLTAFII
SVLEGGIALHLSPADVNVAVGIVERLALQAPPASLGYGSNGGGSDPSSRALVGWPSTPVP
DVEDASFGLTRPVVGPLRESMNQHFGTPTGGATISGGMMHRLGAGGVGSHFAAGKPALCL
VAGDALGARLLGWCTVFCRSPQWRGLFSEAGGGGGGGGGGVLRPLSPLWGEGSSGEEAGA
TGVVAGKKRTAEDMEAAGEEGSGGAQDGGAPTPPPPAKKASASGGSSSGEGRGEGDRPAG
LERLLCVVSQVVRIVKEHTKVAKDKAGAAGFFAGTSVGGGGPRGVPVFDVRTRESSGLAQ
AAVGALADAALDVFADHMEDPALHGRLRRDARVTGEDAAAAAGEEGSTGLGRGRGAPMAM
SDLLPLVDSTSPAETVGLSVDLIGDIAWLFSSLEPETEAGTGGRGGTAASKAGPAAAQLS
SAMSCWASGRVLACMPGREHLEYALCLPSSSAAGGSEEPAVQAAGLPLVRPLPARLACFA
VRNLLDNVQILGQASAASGARSGGGTSTRSGFLTRGKKRRGSAASLPGDGGGGGDAGAAS
STATPSKWTSLMGQQVMSCLDRVHLAGLLLAWESCHPWIEREFPTAAASSSGAAAGRLSL
KQSRSWQSFCSLMGLLAQACVSPRPPPPPGQGLAALVTQAVLSFRATSRSASDALPFLDM
PAVLLLCKVQGCLSSTTAMEDKESSSRLAQLLWDRFFTVCQSHVVFWEWQATLEGPARSS
RPPPYGAIFRHHAQLLAYTYFYQVLEVRRGLLAAHLGLVRRLGATVVARGSSAVGAGGPQ
LLLAQCMTLAEFLLRTTHDNEQSLAQTARLRRDLARLSDVPPATAAAATTTASGGSSASP
TTPRSWFLSVFAADEDAGILAMHERPGVARASSRALCSEVSADGFEGWRETWLGVLAAAA
GSTAEDSTYLFFAALRLLGTLPPREVVGGGPSPAAARLARLSPGVEGMCEIRFCLLGLQS
SSSEWGLLSPAFAATLASVREGLPGWFGVEPRDLAGALVAGCARTATQYELLVGQQRIHG
LLEVFAVYARAAVTTAEGGLTGGGAQQHATGDDDDTESSPKPLVGLSLGLMQLAEECVAY
YHRTIEAALTALHAVGEPEQQLGEDSRLPGARPSDDSFLVGGLHTELNNLNGEPPLDALP
PWQVKACTSSTTRGSQSPSKLTGPFAEPNESGSEVGSRTRDARLQRKWEVMANGATWLTV
ASSKAFVGDRDGGELDGGGGDQAGAGGTPETMAESSSRRKVEAVVDSATKICGSARSMLH
AVLLSVLALTDALASAGKATTPSKTRQGAAAAVALLDGGGRQETASEAWSAVAFRAGALW
GELSTKPWCKWFAPLCGRAFDRLVLRADRKSAGGMSATQAERKREEARGALQLWKKVTGS
WQVRRADTLLRLALEAPGQDTTICAKVALEEGLEQLIALLVIPQTAGSVVGYYGRQSVGT
SSDGDVVARAIASVVPPCSPTVVAGEAAASDSMEVEPDRTPARNADLIVTRGDVSTLTRL
LERSEFSDSLPKTLMVLEAALEAEADAYTVSSSAAPKEHGRPLTSAVACAFSSWPEGVVE
RLVAGAVSSRPQTNAVVVLSLAAGYPAACRGASPPEAGGATGEQQGILQKRLFHSLLATA
TSWVGRRDSVGGASFTGGRGKLDGRNAAGGATDLASLLLWLASKHGMFTELVVAVMGVAR
GLVRALELRAESRDEMQVEEEEEETGGEEMGEEETAGSLARCLALMATVLGPAEGTMDEE
GETDAEDTGSSGDLAEWIDDAGKICRRGPSAGWDDQGVADAAAAANAQRQRQRQQEEEPP
LVCTFVSSHKQFVNQHWYHCYTCNLVNDKGCCRLCARVCHRGHDVSYARLSCFFCDCGSS
TAEGGTPPPSLENSPASSSGGEVVSPSGRTADTGGGGGGATSREVCRTKCSCLKPRTRRE
LNALLHPPPAGSKAGDVGSNAGDARDGSNAKRMAGHGLESGGMGSSPRGGSAAQAAASRA
KEATEGAAAAAAAAAAVAARAVGWRDSSVEMASMRAALFGGGGDGGKPGIAEELRAAFSV
LFARFNAMHAPAGGGVGDGNGGGGGGDGGRGTVSRYAGRNRSAGGAPGAPRVTPWDALCD
ALESYVTATPSPESPPPPAAVLRCRPLHDPNARMPAYPILAPARLLRNGSLDVRLPADGV
RARQDRAAMTLHGVVRRNLAASSCGKMAVAEAQKVLIVDPVGALALRYATAAAVGGGGGG
GGSGGGSGSSGTGGRGSTATPVGAQGARAAAASSLSGPADIPVDRSHLCVLSSMAVGFDV
IGVAFNPANERHLVVWGLRQCCVVILNSRGVALRRVQVNLSFGGFGSGGDGGDGDRNGGS
GAGEDCSTCVLKAIWVPGSQILLAAVCTQFIRVYDLSADAAAPIHTFYLPATAEDASGDG
AGSCIRDVVLVPATLPPATPSSAGTGPAAPGGLPAEPSLREGNAGAPALLATAVVLTGAG
RLYGKGIPGPKSSEPGSSGGGGGAGHAAHDGEIRHRLVIPAPLEEEATQVSGAGGGGGSG
PGRNGGGGGGAGDGSNSESGGGGGRGGRSESVGGASADTGGGSGRDVEEVESPMSGMDSP
SSPSYLYLSAFAGCDFDDVVNDSPDDSVIFAEPGLRRRGWAGSSTGAAAASSSSAAAAVS
AADAVLAMSPGRSARASAEASETAAASFGALHFSSATGLLVVARGGKSTLALRLRGAGRM
TEVGGGFVLLPRLTGASAAGGAGAVVTAEGGVTPVAQGTLSGPARSGEGNAAAAAAAAAA
AAAATLEANSCLPPYTRFLDYWDAAGDLSAGENGGAGAGVGNAAAAPSASLVCVAVGGGR
VKADRVLAMRAGAGSGEGHTAELELQHLRWPRRSVAQVGPAAFAALSRSLVAGTVQGMCV
CPAPPPPSPSSARLGLRPGAATSGEELNGGGAGAGRGSYGAGHQPPYVTPVLMVLFDNGS
VQCYTSPAHLTAVEKERTRAAEQEDSAAAAAAAAAVVEAADASPARPATQPLGSPSSPPL
RSDGGTAALAAAGGAGTAASSEAAAASRKCSSRKKTVARRGVTYRPRLWQQPPPLTSTAR
RPGDRIQRMAWSPYLTSGSSDGEDVGASLPSSSASRRRSSLRSGGGTNPSPAAATVAGGS
GGGGGGSSSGHDSTSDDEALVSFRSRVPPEDSDRSQSLASQLPPGDSEGAPRFPIEIFES
LENVTADPRLCYCGHAIDPNHGDRQVRSKLSRETPEYLITPRAEGGSIGLWLRGCPGLRI
AAVRVQLGHASVDHIPRELRIMGRTIQTQKGKAKWYDLPLTEQEIERGNAVGPVVVSVSS
CADASNHPLIDALEVYARPYLGAAAAAGAPAPPLPPGPTRSSSSSSSRTDEAQPSALATS
TMEALEACSRVLSHALGLAEEAAPTREALCPELADSALTVLRKTCLAADKTRWRALRSSS
RRLLATAKPDAAARVDSVHRAYVGEVLLALAGEGGFDGGDGGGGGDGTLGKENSPLSPVR
LTRVTQLCERVCAKRSTLLRDELAPALAEKSNGDGDGGGGDSVGQSGRRTQLARSFVFPA
LVRRFWESCVWVRDGRGSMQMVLRCILQLAVDEMRAAAVAARAAAANGACGSSSSSGGDV
IEEGSEQAVLRAGLGQLIPLLQSNVARVSEASSAYLATLLLGTLPAATAAVGVPRPTAAA
AAAAPVAADGQRQGESAGGAGGVTASGGEGLGSGAANAAATGVVISSRVGVVSDAYAASA
GSASEAEGRIETEATSDGGTESDADPAGESAAAAADGGGGGHHAEEDSSSSVQLALAGLR
RAGHLSGAGAEGQGRAAAGGGGKDASPGQEGYGIDLVPGSVKRARTTSSAAPSGRDLAPS
NEGGAGRGGGVDGAAGQEAALTGAEGAAARQSARGSPGAAAGGAGARAAAAMAAAPGSSA
SLSKKQVCYRCDSCDDCPLQHVRYHCLVCADFDLCARCYDRYHGPNSQFQGENAVMLGSH
STSHSMVALPVNSAQPAGASVPTGAPQSPPRNSNPPPAAAAEAEPRSAIVDRNNAGSRSV
LWGRKQLPKTLQAITKGAAVVVGGGVRARSAASDSTILCMQTLRFLVGWGEPSDGTGGKS
VHRVEQPLFAASAMTAAGGFEAGAGEAPICLHGLRARPSSDDSGAAAAVAAAAAAGGAGG
NPTGPSTVCFVCPLEDRARRCEFVQVTRQAATAGAADDAAASTTNAGTAGGRSVVSGRHH
KTGSKNPRTPPAAAAAPLQRAPDAALRQAVGRACEELLANAFSSSFIPIVTAVPPASEAD
HTGPPSSAPPPPGDGGGGHATGTGGGVPGSGGTDAMDVDREETQGSARPSAAVPAGDSGG
GGDNVQAVLCSLLKALMTLLLSDGGGRSSSGGGTESSVTAPRRVVSSTAKEDESAAGAGR
AAAAGSSGQGRKNASKPPRADGVSGDDSKRRSSRSSGLVAAAAASGGAGAPSAAPVVAST
SSSSSSSSKAEMMRRAAFRTPAEGLTRLGAILRVPSMAVLASAVQLATALASMSRRLERM
AAGGESWGAPPNAAPTADSGERPKHPQTSSPPTAEVMRRRHKGLTEWKALLCTLIADREV
KSLRHDAKRLLRRLCVTQAAYHGVRDSYQFTAELRKVLHSLPPRAARAACEALRDPAAAA
GSSSSTRDARGKKRGRWDDAPPCSGQGVAFAAAAVAAGGGGGAGSDVDELPYTTQVALHR
SLTSLLHVAEMRPTNWRRYCAVSWSSKYPRFQGDAAAAGAETAAGGNASGGSGGGGREES
DLLSQFGDLPPVCILFALCENGGGRGRAGRGHPGIGASELQPLIWQLLELTLRPEYHHHV
SGAAMPPPPPPPPLPPPMAAPGSLLRGSGVGGGGSAGDAEGSSRSGEAVVVAGANASSGS
QGGRLALAAGGGAAAVAMAEGSALGGGGAWSFPSPADLLIAKGLVGSDAVVEMAQDLLSP
AADAEARQRTSSVLHHLWASSAADSRPEVVRRLAAYLPFAARQGSRAVEWLSFLALAVQD
AQPPLPPPSSQALTAEQQLSSGDAMDEDKGGGGGDVSPMVALVRAAAAAVAEQAAALSNH
PNAALYAAIGRLVPGVGGAAGGHFLELEPCLVCAEQDSNNSLTAAGKATTAAAAEAESLA
VAGSRSGGAAAAAAAAAAAAGASVPGARGGRGLVYLNYPLDSIKAASKSTENAMLVQLKG
RFKVQRLLVRIADAHGRLVRTIRLHYHSKPVATIADLRMPENAAKWRLAATVHVPRDKVS
VQVDLPLPLTCANLMVEFADFHADPARGAEDPAAVGAGGRRGHSGGGALHCPRCGRPVTD
MHGVCRQCGEVAFQCCQCRHINYESLEAFLCVECGYCAYAHFSFRLIAALETDFTPVTTE
AELAEANRLADKRTQLARNVQQELERLRPRVCQLVASLTGVDNNAAEPSGGGLAQPSYWN
GAGWTGHGEDGGGGGGGIDPDSFSATLRRVAERCGTAWGGEGAGGAAGLLESRLGWASAL
PARAQHQYALMAQEAADEALAAGGGGGARSSAPTGQPPAFGGGGSGAAAAAGAAAAAAAA
AAAAGQEGLRASLDELCNLHDELGAIGRLPAAEAGSGSDSINNLVASIHSRRAHAEARLE
LAAAAMAGGSADPTGGGTATERRVRRGGASYIPKTRRVAAGLSSGAVAGGEAEDGAEASA
TAAATGTSRALVVAAGAGGAASSSSSAAAAVAQARRDVRRGGGGGNEELLLNASGGGGAS
DGGARWERQPQDYVPNRRSSNSRVEEAERMLRESLDEGADPFFSSLPHLPPLASPYQSRG
SNGGGGGGGATGAGGSSVSSAAAAAAASAAPDANNDSPPPASSGYSAELAELVKLYCGRC
QEASSRLRAAVSDREALSASTMSYLRSGGGLDIGGGGSRGGAGSVESTRGRAAATAAKVA
VAGAAGTPAWKAGRGAVSWGGDGEQAGGTGTQRHGCCARCSEEEEPEGREAAACWRLHVG
LLLEILRRMPAAADASLAMVKHVVLPCLDTVAALCLDGVDYPDLREKEGAPPPPDGDEQH
HGAAAAAATAAAASGASPSLPDVEVATPASDGGRVEDVVLDEVLRASADAQALPSASATM
TGGGGFCCRVGWVTPAQAKNAHAATAAAVTAESALCGGGGLQHARFSSFPEHWLLRLMAN
KRSPVLRTFSGMVLGAMAAFKGPRRSKEVAEVAAHMVGVVGADGSEAAGLQVIEILQRLT
GISPTAAGSDPQQRSAAAPGPGGAGAAAAVAATPEARKRAFLRASVRVLRRNTSQSSTPT
SSHAFSGGEARWWSALPPAPLANPSVRQLLKELNDIVDPPRKLPRFKVHLRRAPTQEEFF
RGSLSKNPLYSTDIMPSAPAAAGSGGGGGGAAGSAAAANAGGGSSPSAISGVAEATMRNL
RDKIATDLDMADAADLLELIVCGNIVGLDIPVRVVQHELWRPHILETTADDYSSDCEAES
LPAMMVTYRLAGVDGEATEEVVDSLADSDSAADQDPEVKFGIARDIAEEGGLSLLLTLAQ
PPAGPSAAVEEEAAASPEGLAASGSGDWEVFALAVKLLRRSCMLSANRSDLLSLKAPGIL
LHHLLEVLQRGAAGGGRGQAXX
Download sequence
Identical sequences D8LLX0
Esi0038_0043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]