SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0048_0029 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Esi0048_0029
Domain Number 1 Region: 540-602,1328-1486
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.87e-40
Family Tandem AAA-ATPase domain 0.0013
Further Details:      
 
Domain Number 2 Region: 297-325,362-464,521-618
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.12e-28
Family Tandem AAA-ATPase domain 0.0037
Further Details:      
 
Domain Number 3 Region: 1034-1093
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000123
Family RING finger domain, C3HC4 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Esi0048_0029
Sequence length 1672
Comment conserved unknown protein [1673] r:122321-150989
Sequence
MGKVTLKVECLSTVRTKLLASHKVNFLKIQSRVRRRRWCRGCPGRCCFGDGRGRRPAATH
LRSPAARSARVDDRHGPQSPQSSPWKRPMLRALSTHVSAEDGLTVTYFIYTSRLLFELIA
DPAISGMMKSLEPVAQVTPPAVIEKQPVQFVSTRPGLRRTPAASPPSSAASGTSSGTAAA
RGRAGANGSSSSSSGRRGGSSAGGRGNGQGEEDRSKRGGRGGGGGGSSIGLASVAVAAMA
AAGGGGGGDDSGVAAAAGGGDGGDDSGVAATAAARREYDFSLAGILKSAESSGYRVVDPQ
PADLTVDLFPYQQSSCQWMLDHERDPRGLNGYFWERREWADGGAPLWYFPLAGEFRLAEP
PHITGGLLCEEMGLGKTIEVLSTILANPRDGGSHSSLKHRKSLREQPDRHFDSARRLVSR
ATLIVVPVSLVGQWAEGHVELTADQVRRIENRRLFDSDRSSDDANLTARAASTASTALGG
GTGSGNGSWNGTAAAEAARGAEDETVRVDFKVDAALVADNDVVLTTYELLRTRKSLFQKI
NFHRCVLDECQEIKTATTNIAQMCQQVKASHRWMVSGTPIAGKIDSLHGELNFLQVWPFS
LQNDGFWEKKVGEPFEAKDYGALELLRALIGVVMMRHSKSQTYVDGRPLVKIPARTVEWR
GVEFSSAVESGQYSNASAPHARYVYKYLENLCATVCRKMEENVARESSAGGSAGGAEANG
MGRREFTKLKSLLALMQKASTHPGLVNLGQLDMLKRSIQVVAPVQPLWQWLPVGGMAGPA
PMASQLQANVQAELKARADAIETLPAEEVLRRLAQKGAGNMGGLNRNRGRGTVTGPSAGR
REITLRDSLQAMPLSQLQHRLEEEGLPVPRSWAVLKPKADIVTGSVDLRFGVAPPPALLP
AAPSPPSGSVAEGDGGAESGGGSSNSSSGKTKGKGKRKRDEGQADFDVRKLLKVSDTIRV
GVNSEDNEATIEDIGERSATLACEWSEGAVKAGSVYRFSTSTRRKPYVDLLVASDKAKKD
TEVQVAGFSAIYKAMAGEPVSCPICMCSVVRPTVTKCAHLFCRECISRELQRTPALGMIQ
LPQAKCPICRRTMKGSEMMELQTLSEVEEAMAIDASSAADNSSGDAGAGAAEGGPAAASE
GGGSSSGSSGSGSGKGKKKARREGSEDDKEEEAEEPTCGHEHSHETNTAAGAGASANNGA
SASAAAPSDRAAATCGSGGSGGGSGGAGSGGGARSNGGSVAASSNERGGVGPTSTSSRGP
SGVSTGDPRSAAAGASAAGDGSAAGSGGMVAGAAPAAAEEDGVAGPSLVIPTFRFTPTAT
ATFLSQYRAATSSQSSVKLDALVRDLDTTLLHDPTAKFVIFSQYPQVVDRAGIVLSARGI
RSTSIVGGRTRVERSSAVSSFTNDPSIKVILLTTGSAAAGLTLTAASTVYMLDPVWSAAD
EAQALNRAHRIGQTHTVRCVVFYMKDSVEERLLALRHSKGNFAQFLESADSVVSLAAPEG
SGSGSSSPLSSSFVNMFALPELKKLFGMVGSQPAGATGGAAASSSSSTPAQRGGGSGSGG
GWSSHAAGGGPGSSGVGAGVGARVPLGYLSSSDSDDDDSDGDSDRSLAVGGGGGGGGGRA
NQEQRDLARAMAMSRAVFEAGHLGRASGGGGGAGAGGGSGGAAGSPLDLTRP
Download sequence
Identical sequences D7G2K8
Esi0048_0029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]