SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0051_0097 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Esi0051_0097
Domain Number 1 Region: 785-819
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000113
Family RING finger domain, C3HC4 0.0084
Further Details:      
 
Domain Number 2 Region: 542-617
Classification Level Classification E-value
Superfamily TPR-like 0.00000539
Family Tetratricopeptide repeat (TPR) 0.04
Further Details:      
 
Domain Number 3 Region: 388-466,567-651
Classification Level Classification E-value
Superfamily TPR-like 0.0000158
Family Tetratricopeptide repeat (TPR) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Esi0051_0097
Sequence length 935
Comment TPR repeat-containing protein [936] r:641579-646683
Sequence
MFRCMLNMFNAPCLRCIINPYPKTNNSNAGAEAAQRHALALRCREWEGRDGGVFAGGDRP
GGDAGPGAGSNSGLLNPSSAVVAAKRAAVPCLRNLASFVSNQGRHVDAEVVLRTVLNILR
DYKRQLSSQHHDGKGKREADAPLLDGGGGFGTDSASFTPSSFEEKRSDEAQADAGSPAPS
PTPDTRNGGTRNGSPAAHPTTEPPPLSAVPETGIAGGDESLGRDGSTANTTTGGDAYESG
DPPAGSRPSAETAGGGSGGGVGGGVGGDNLRSHAAQATAALAEETVASAMVAATRAVAVM
GETAATLEPSSLVVNHNRATRSDASPAPPPPSPVPLMKQASAGPTAGRRGGRLEESRLPG
MKFGRGESGGDERGLEDVEGGEDEEPDQMAAVTRHHLAVVIHAQGRAKEAEQLLEDSLRV
LKRRKPPQAVCVAQAMHDLAGIVRPADPARACTLYRQALKTLEDARGVNHFLTAPTLAKL
GALLGESLVAAADIPITPAQPAGPGCAGIQRSAGLAEAVCASAGCGVEDGSAVAAAAGVD
WDPKKAEEMIKRAVLIQGRHLGLRHPAVASSMRAMAELYRRQGRLAEAEPLFRRAIGIWE
LSRGGGGMDSDAIAALHGTAHCVLAGAGADWLGRFEEAFALVDQAYRIASSHPGNDASSR
LLLEALRMIRSRQRQGRGDPQPASAAIMEGVWTGRWDPAKNDGTSGGGATQGRHVRSRSN
GDGNPRCAVCLEEVGGGEPTVDGGALGREGGGGAAAAAADWTADIGSEEGLRAETAESVH
ASGSFAYLPCGHRFHTHCIGRWLAHSSSCPSCRSQVEEETIPTAVAMDATAPPSPPDEAR
GHGARAVGGSRVAASRNRLSTPEAEAAEVADSVLTAAANSVLTAATRGVAGQAQRGGDAN
GRVGFVGVNRRGGGGAAAGGGGSSAVAVEERAPFC
Download sequence
Identical sequences D7G3J8
Esi0051_0097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]