SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0052_0140 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Esi0052_0140
Domain Number 1 Region: 140-356
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.94e-45
Family Ankyrin repeat 0.00048
Further Details:      
 
Domain Number 2 Region: 9-58
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000012
Family RING finger domain, C3HC4 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Esi0052_0140
Sequence length 358
Comment EsV-1-142 [359] f:516557-517633
Sequence
MSSSSATDADEQCAICRSVITGSCNKSTTSCGHSFHFTCLARSMRSSSICPICRTDLAGP
NTRDEDTEMKDDIDTDIDVHEHSDGETEEEGEVRLPRAARTGARREVIVTEIRDGSSMSD
IPVFGNEVDLRREILEGIMHSMCQQGDLAEARNLLDDNPRLQYSRGSTGDLLTHQAVLSE
NESLLSYLLNEKAFDTNLPNDVHAYPLHYAVLSGSLRMVTILVNNRAFVDCTDSSKKTPL
MIACEEEDHDIAEFLLDRGASTMTQDACGNKPIHFAVRSRAQACLRRLLNSEAEVNAVNH
MDETPLFVACKSGFHGVSRTLLRAGADPEKRNKFGTSPLDEASSNGSSSLVELLRRYV
Download sequence
Identical sequences D8LPG8
Esi0052_0140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]