SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0053_0001 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Esi0053_0001
Domain Number 1 Region: 24-89
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000542
Family RING finger domain, C3HC4 0.019
Further Details:      
 
Domain Number 2 Region: 104-164
Classification Level Classification E-value
Superfamily TRAF domain-like 0.000000000347
Family SIAH, seven in absentia homolog 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Esi0053_0001
Sequence length 577
Comment conserved unknown protein [578] f:2270-6024
Sequence
MESPLAEVASPPVEEPPGEEPGDAHGDAWSCPICFMWFDMPVSPPCQHTFCAGCLKSVVR
AAAHRQRRSGNTGPSGPACPLCREPFTPEVVQPSARIFEEMLKATVTCRNGDCAAQFCPL
RWKKHQEECPSAVVQCMHHLVGCEWKGARRDLSLHVEGCAYEKIKGLIPRVSASLKQIHA
QVHQLEARVMAQNAAVANTRALLAHQRRAGSVFPAVYALLWRPPNWRLYQSPRPGGGVLS
NVTLICLAPILFLALCGAGVFGGGGGLVVEERAVCLVGVAILGFVALLEHDNESPYHELQ
TPSLLKGLAIGEFLLEGTARSMVYFALKGLPDWKRTAALLFLLAPLFYPTVVQAVHRFEV
QVKNAHNQAQRARAQPPLPPVEPVAVKTHDTVVNGVVRGTTMLLMNPVPALVGEVLAKLG
VFVVSAALGPEKLDAFLEHVWLVMSAGIALDDKARLKKRHDSIFRDLRTPLPNMTDRTTR
RLIAAVCVCLFATIVTFFRDILQMVGYSRLLLSVLDSAHFRWELHIGRVVMGSLQQTRTN
QDPNFARTRARDLLRSRLLLLWVVVGSSFFLLFMLTS
Download sequence
Identical sequences D8LPN1
Esi0053_0001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]