SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0055_0045 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Esi0055_0045
Domain Number 1 Region: 238-287
Classification Level Classification E-value
Superfamily RING/U-box 0.00000812
Family ZZ domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Esi0055_0045
Sequence length 330
Comment conserved unknown protein [331] r:287060-293791
Sequence
MAAKMATPLEGRGRKRKRQVSWAAAELLEEVKLFHMAKPVNPSIPPPVVDDGGEDAASQP
GLALLGLLGVESSSSLPASTSSFSAASPSPASVDSSSTTFHAPVGGAGIVNGGDNSHPST
TSAQLPSDVQGGSFVGSSSHSGDGPGGTEGGPATGRTVGASRLFKGFEKTETVVRRKKLA
PPPPPAGAPPPIPPSGEGEHVTHRYPKDIWPGHKPPNHIVGGEGANDGERAGDEEQLEFF
CDGCDETIPSGVERMECAVCPDEFCLCHACYDEGEVLDKRHKHELLPSAAPFHVTRAAPS
AAAALEAAKALHVAEAHHGQGLAYDEADLG
Download sequence
Identical sequences D7G479
Esi0055_0045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]