SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0056_0103 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Esi0056_0103
Domain Number - Region: 137-189
Classification Level Classification E-value
Superfamily UBC-like 0.000111
Family UBC-related 0.056
Further Details:      
 
Domain Number - Region: 374-416
Classification Level Classification E-value
Superfamily RING/U-box 0.00265
Family RING finger domain, C3HC4 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Esi0056_0103
Sequence length 450
Comment conserved unknown protein [451] f:627066-640063
Sequence
MADLILPLDPSQRHFGGYVEAMGRQYRVSMACPQGRRGIVDLASFRCDPELSALLEARGV
WDTLRARLAQTEDVEGFMAELTDVLEKVLRSCPKQDPPPAEFYSRLVSEIDAVGWSHLVS
MDSLLTSVQLRERDAAGREHVFAISLPSNYPHSPPICSVDLPTHLNLRWSPGQSSLATVL
EQFREALTPFHELWNVLDDLDKHTWVLEPEKPSRSTTHRRVAVARHCSVMLKIDPRAPGD
VPEVRFLGSQAVIGPLREAYERNLFRWNHSLLVRANLEAALELKLPSPATTAKADYSADC
GICYAYRLQRDDAAGDGGAAAAAAAAAAAAAVGAAGGGGGGGGTRGRGGGDESGGRGAAA
EDAGAIPDRVCDNAKCRRPYHPKCLFVWLQGLPTSRVSFDTIFGQCPYCSDPISVKFAPN
GQKEGRDELGLVDGRRQHTHGRMRTARKTA
Download sequence
Identical sequences D8LQ11
Esi0056_0103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]