SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0060_0128 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Esi0060_0128
Domain Number 1 Region: 3-553
Classification Level Classification E-value
Superfamily SIS domain 8.39e-175
Family Phosphoglucose isomerase, PGI 0.000000001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Esi0060_0128
Sequence length 559
Comment conserved unknown protein [560] f:739036-750643
Sequence
MAIHETAAWAALKEHAASLQGAHLRDMMRDEDRCAALTAERDGILLDYSRQRVTNETMDM
LFNLAEAADLAGKRAAMFTGEKINNTEGRAVMHAALRAPREATMNVDGKNVVPDVHSVLD
KIEDFSARVRSGVFKGCTGKPLRNIVSIGIGGSYLGPEFVFEALKCEPAAQGASTGRTLR
FLANVDPVDVSRAISGLNPEETLVVVVSKTFTTAETMLNARTMKDWLITSIKGKTAAEIT
SQHIVAVSTSDKLVQDFGVDAANIFGFWDWVGGRYSVCSAVSVLPIALHYGFDIARRFLD
GAHDMDNHFLNEPPRQNIPVLMGLLGVWNSTFLGHGARALLPYSQALLRFAAHIQQVDME
SNGKRVAQDGSVLPFDAGEIGFGEPGTNGQHSFYQLIHQGGVFPADFGGYCTSQCPVLLE
GDPVPNHEEFMSNFFAQPDVLAYAKTAEELEKEGVPEWFRPHKVFTGNRPSLSLLFPKLD
AFSCGQLLAIYEHRTAVQGFVWGLNSFDQWGVELGKKLATKVRTALSTARTSGGDVSEGF
NPSTSTLMTYYLANGASKS
Download sequence
Identical sequences D8LQV8
Esi0060_0128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]