SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0061_0008 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Esi0061_0008
Domain Number 1 Region: 450-507
Classification Level Classification E-value
Superfamily RING/U-box 3.83e-17
Family RING finger domain, C3HC4 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Esi0061_0008
Sequence length 556
Comment conserved unknown protein [557] f:71495-77626
Sequence
MSGRTMPFQFHTRRPSAVVRQSGPGRSTLHVDLAAGGGATTAAAGAAAGGAGRGTGGGGW
RGRRGWWGSSRRLPDFLEFWGFAAAVPEDERLRRERERRERSHRRRGLAGSCVRSPEFSI
FVLGLAALLAFIVFICDMITGRRLRPTSVLVFVAAGTYCLALIKQQRDLAASEQALVIEI
MDGSATSSSRRVISKEDRRNLFDYFTFRRSSSTNKGVWTAATATQTDKDAEVSAMEQGTA
APTAAAAATAAAADDDGEVSGGGDTSDREDEAGSPRPCSLPSPLGLSAPTRGPRGAGSDT
AAPPSPEQPLATPPVSPSALALAGTLQGEGAAAAVGGVADDGTAEVLGGVEVVGVSGKEE
GGGVMMLAPSSGAAAGLSPLFSVALGRDEGESAIRGSCCGGGVADSDESGEGGSGSKPSV
AGPEKRPPPEGEEFDDKEVPERGMTGGLSELWSSGESCIICFGEYAEGDVLCRLPCRHTY
HAECIDAWLDGPGHSWCPLCKSSLLPPSEPRNGSDNDEIGGAGGTNATTTSADSNAEWLG
SSAPAAGAATVGDEAV
Download sequence
Identical sequences D8LQW5
Esi0061_0008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]