SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0062_0004 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Esi0062_0004
Domain Number 1 Region: 423-472
Classification Level Classification E-value
Superfamily RING/U-box 2.33e-18
Family RING finger domain, C3HC4 0.0023
Further Details:      
 
Domain Number 2 Region: 112-137
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000173
Family Ran binding protein zinc finger-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Esi0062_0004
Sequence length 473
Comment conserved unknown protein [474] f:6952-10060
Sequence
MDATCWVCQRCGHEVPIDNREVHEAQCRRNSPAQLLSPPPVTGSPPSPFDPDNQPFSRNV
FTPAQPPAAEAAARESGQPCGFAAAGRGAASAAAATGARGASSTEGEGESGDTTTWACAA
CTYLNDFGVSRCDMCGTRMSPQQRPPDATYRDTLIGGGVSGGRRRRQAGAAGDLESAAEE
ARCRMLAAAAAARERNGVSTSGGGSGGRGGEDDQGLLDGRTTISGAAAGSAIGAIGGALL
SAVQPGARASGVMSSMFQGALMGGMAGAALGGLSDEPGAGGGSGGSGGGSGGGGGARSSD
DEFRRQRRRQVSSFEFVRGPTARVRRGRDVVSEMESLMLARRLEALSLPASAAAMRREGG
GAGAGAGSSIYAGILRQLAEAQNHDAAGGDAGGGGGTSPASARAIAALPGEALTAGALAH
LKDDGRQCCICLEDFEAGEKATRLPCLHLYHTVCIENWLQTSGTCPQCKFRVD
Download sequence
Identical sequences D8LR18
Esi0062_0004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]