SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0062_0093 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Esi0062_0093
Domain Number 1 Region: 382-484
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.00000000000275
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0091
Further Details:      
 
Domain Number 2 Region: 62-168
Classification Level Classification E-value
Superfamily PH domain-like 0.000000226
Family Pleckstrin-homology domain (PH domain) 0.028
Further Details:      
 
Weak hits

Sequence:  Esi0062_0093
Domain Number - Region: 828-870
Classification Level Classification E-value
Superfamily RING/U-box 0.000927
Family RING finger domain, C3HC4 0.016
Further Details:      
 
Domain Number - Region: 526-591
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.00262
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Esi0062_0093
Sequence length 876
Comment Phosphatidylinositol-4-phosphate 5-kinase, putative [877] f:512379-518552
Sequence
MGNEQSFEGQAIPENGLRLSTLCRYQAEPGDEDGLAFSWFQASTDVSGLVLRGAHRYGYV
LSHVGGQRLFKDTRQRFFVLLDHYLCFFDSHSPEARMKGSIDLDKTHCHIELLPRPPETV
DTILQVGGGSGSSSEGDEHRVEVTRRTDEFSMVLCFSSATSLSDWMKSVFDVQQRKATFS
PLRHGTGGGGGGGGISSEGGESSSDGSDSSSDLPGSLPRAPTYINSRGNNSSGIASSGRG
GEGGGGGGGIGTGNRQGRRRGGRRRGRRRGTLGSPPPRPPRGGGGGGLRGVPSSWADDID
IRANEGGGGRTGEAEDAPPLRLRPRHMSTPTSSAVRLGKASERLAGLPRGGRAAGNNASS
SSSNVSGCSLDEYGAFTTAQASIYEGWTRGLQPHGWGRMVFANGDRVEGWWEHDVLHGSA
EYTSRQEGWTYSGGYENGERHGPGRLVFSSAGGGDVWDCEWDRGVVARGSRGTHATADGE
LYQGGCGPSAADPAMPVRSGQGRLRRRDGGQVDTRFRAGRAVDGAKGVVRFRNGAIFFGE
LQEARPHGRSSRRKPRGSLAELHEMARDVLWYKGDFRLGKPHGSGVIKYKDPAPSLPADR
GVGGAVAEEERGGAGAGPPGRPRVRASCESKDEYDGEGGEPEAKQGGAEQEEEEEEDEEG
EEEEEEEEEEEEVAVPLVVGATDQDLLEEDECTSDSEEEEDDEEEEEEEEGDGGGERRRG
LRRSGNSRRGALPEGGEEKAATALAARRGQRAPADGSGGTGGGGGGGGGGSGADMEYEAE
FVDGVMVRHDAEHLRLAALRFGRAEIRRLETLLKKEEDAMSRLRVKGLCLLCNVEEMNAL
LVACRHKVLCMGCASRADRCPVCNETIGKVVRTYST
Download sequence
Identical sequences D8LR56
Esi0062_0093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]