SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0063_0057 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Esi0063_0057
Domain Number - Region: 95-146
Classification Level Classification E-value
Superfamily RING/U-box 0.0388
Family RING finger domain, C3HC4 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Esi0063_0057
Sequence length 283
Comment conserved unknown protein [284] r:285658-289219
Sequence
MRQTAGEKDEESQEEEDEDEETMTGGEEDEEQEEEEVEPVLYDEKAVEWMMHQLCMYQTR
TALISNPLAEKGYKLREIVPSPRGLLCAVSTEERRMDCRMYVEAEVGKKVVAPCKCKGTQ
KWISFSALNSERRKEAAKWKNCPTCQGPIDYALYEAYGGGAGKAVSAILNNSRATRVAIG
VLATMVLWLLSPLLHVLIVRVLTSGVLWKNYHRLTFIVNLPLPLQIMGIRFLMTWTNDQL
LLVESMVRQSLTDIESRILESRLPVTVEVREDGDEIAVPYRKP
Download sequence
Identical sequences D7G587
Esi0063_0057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]